SIVA (SIVA1) (NM_006427) Human Recombinant Protein

SIVA protein,

Product Info Summary

SKU: PROTO15304
Size: 20 µg
Source: HEK293T

Product Name

SIVA (SIVA1) (NM_006427) Human Recombinant Protein

View all SIVA recombinant proteins

SKU/Catalog Number

PROTO15304

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human SIVA1, apoptosis-inducing factor (SIVA1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SIVA (SIVA1) (NM_006427) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO15304)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18.5 kDa

Amino Acid Sequence

MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDEGCAVVHLPESPKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET

Validation Images & Assay Conditions

Gene/Protein Information For SIVA1 (Source: Uniprot.org, NCBI)

Gene Name

SIVA1

Full Name

Apoptosis regulatory protein Siva

Weight

18.5 kDa

Alternative Names

CD27-binding (Siva) protein; CD27BPCD27-binding protein; Siva-1; SIVA1, apoptosis-inducing factor; Siva-2; SIVAapoptosis regulatory protein Siva SIVA1 CD27BP, SIVA, Siva-1, Siva-2 SIVA1 apoptosis inducing factor apoptosis regulatory protein Siva|CD27-binding (Siva) protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SIVA1, check out the SIVA1 Infographic

SIVA1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SIVA1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO15304

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SIVA (SIVA1) (NM_006427) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SIVA (SIVA1) (NM_006427) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SIVA (SIVA1) (NM_006427) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO15304
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.