B3GALT5 (NM_033173) Human Recombinant Protein

B3GALT5 protein,

Purified recombinant protein of Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 5

Product Info Summary

SKU: PROTQ9Y2C3
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

B3GALT5 (NM_033173) Human Recombinant Protein

View all B3GALT5 recombinant proteins

SKU/Catalog Number

PROTQ9Y2C3

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 5

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

B3GALT5 (NM_033173) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y2C3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

36 kDa

Amino Acid Sequence

MAFPKMRLMYICLLVLGALCLYFSMYSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTWGKERTVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACHFIKPRTLLDYWQALENSRGEDCPPV

Validation Images & Assay Conditions

Gene/Protein Information For B3GALT5 (Source: Uniprot.org, NCBI)

Gene Name

B3GALT5

Full Name

Beta-1,3-galactosyltransferase 5

Weight

36 kDa

Superfamily

glycosyltransferase 31 family

Alternative Names

B3GalT5; B3Gal-T5; B3GalT-V; B3GalTx; B3T5; beta-1,3-Galactosyltransferase 5; Beta-1,3-GalTase 5; Beta3GalT5; beta3Gal-T5; EC 2.4.1; EC 2.4.1.-; GlcNAc-Beta-1,3-Galactosyltransferase 5; GLCT5; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5,10Beta-3-Gx-T5; UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 5; UDP-Gal:Beta-GlcNAc Beta-1,3-Galactosyltransferase; UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 5 B3GALT5 B3GalT-V, B3GalTx, B3T5, GLCT5, beta-1,3-GalTase 5, beta-3-Gx-T5, beta3Gal-T5 beta-1,3-galactosyltransferase 5 beta-1,3-galactosyltransferase 5|UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5|UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 5|homolog of C. elegans Bt toxin resistance gene bre-5

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on B3GALT5, check out the B3GALT5 Infographic

B3GALT5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for B3GALT5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y2C3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used B3GALT5 (NM_033173) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For B3GALT5 (NM_033173) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for B3GALT5 (NM_033173) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y2C3
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.