ZNF213 (NM_004220) Human Recombinant Protein

ZNF213 protein,

Recombinant protein of human zinc finger protein 213 (ZNF213), transcript variant 1

Product Info Summary

SKU: PROTO14771
Size: 20 µg
Source: HEK293T

Product Name

ZNF213 (NM_004220) Human Recombinant Protein

View all ZNF213 recombinant proteins

SKU/Catalog Number

PROTO14771

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human zinc finger protein 213 (ZNF213), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ZNF213 (NM_004220) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO14771)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

51.1 kDa

Amino Acid Sequence

MAAPLEAQDQAPGEGEGLLIVKVEDSSWEQESAQHEDGRDSEACRQRFRQFCYGDVHGPHEAFSQLWELCCRWLRPELRTKEQILELLVLEQFLTVLPGEIQGWVREQHPGSGEEAVALVEDLQKQPVKAWRQDVPSEEAEPEAAGRGSQATGPPPTVGARRRPSVPQEQHSHSAQPPALLKEGRPGETTDTCFVSGVHGPVALGDIPFYFSREEWGTLDPAQRDLFWDIKRENSRNTTLGFGLKGQSEKSLLQEMVPVVPGQTGSDVTVSWSPEEAEAWESENRPRAALGPVVGARRGRPPTRRRQFRDLAAEKPHSCGQCGKRFRWGSDLARHQRTHTGEKPHKCPECDKSFRSSSDLVRHQGVHTGEKPFSCSECGKSFSRSAYLADHQRIHTGEKPFGCSDCGKSFSLRSYLLDHRRVHTGERPFGCGECDKSFKQRAHLIAHQSLHAKMAQPVG

Validation Images & Assay Conditions

Gene/Protein Information For ZNF213 (Source: Uniprot.org, NCBI)

Gene Name

ZNF213

Full Name

Zinc finger protein 213

Weight

51.1 kDa

Superfamily

krueppel C2H2-type zinc-finger protein family

Alternative Names

zinc finger protein 213; Zinc finger protein with KRAB and SCAN domains 21; ZKSCAN21CR53Putative transcription factor CR53 ZNF213 CR53, ZKSCAN21, ZSCAN53 zinc finger protein 213 zinc finger protein 213|putative transcription factor CR53|zinc finger protein with KRAB and SCAN domains 21

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ZNF213, check out the ZNF213 Infographic

ZNF213 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ZNF213: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO14771

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ZNF213 (NM_004220) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ZNF213 (NM_004220) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ZNF213 (NM_004220) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO14771
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.