RAB14 (NM_016322) Human Recombinant Protein

RAB14 protein,

Product Info Summary

SKU: PROTP61106
Size: 20 µg
Source: HEK293T

Product Name

RAB14 (NM_016322) Human Recombinant Protein

View all RAB14 recombinant proteins

SKU/Catalog Number

PROTP61106

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human RAB14, member RAS oncogene family (RAB14)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RAB14 (NM_016322) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP61106)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.7 kDa

Amino Acid Sequence

MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC

Validation Images & Assay Conditions

Gene/Protein Information For RAB14 (Source: Uniprot.org, NCBI)

Gene Name

RAB14

Full Name

Ras-related protein Rab-14

Weight

23.7 kDa

Superfamily

small GTPase superfamily

Alternative Names

bA165P4.3 (member RAS oncogene family); F protein-binding protein 1; FBP; RAB-14; RAB14, member RAS oncogene family; ras-related protein Rab-14; small GTP binding protein RAB14 RAB14 FBP, RAB-14 RAB14, member RAS oncogene family ras-related protein Rab-14|F protein-binding protein 1|bA165P4.3 (member RAS oncogene family)|small GTP binding protein RAB14

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RAB14, check out the RAB14 Infographic

RAB14 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RAB14: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP61106

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RAB14 (NM_016322) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RAB14 (NM_016322) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RAB14 (NM_016322) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP61106
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.