POLR3K (NM_016310) Human Recombinant Protein

POLR3K protein,

Product Info Summary

SKU: PROTQ9Y2Y1
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

POLR3K (NM_016310) Human Recombinant Protein

View all POLR3K recombinant proteins

SKU/Catalog Number

PROTQ9Y2Y1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa (POLR3K)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

POLR3K (NM_016310) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y2Y1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

12.1 kDa

Amino Acid Sequence

MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD

Validation Images & Assay Conditions

Gene/Protein Information For POLR3K (Source: Uniprot.org, NCBI)

Gene Name

POLR3K

Full Name

DNA-directed RNA polymerase III subunit RPC10

Weight

12.1 kDa

Superfamily

archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family

Alternative Names

C11; DNA-directed RNA polymerase III subunit K; DNA-directed RNA polymerase III subunit RPC10; DNA-directed RNA polymerases III 12.5 kDa polypeptide; hRPC11; HsC11p; polymerase (RNA) III (DNA directed) polypeptide K (12.3 kDa); polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa; RNA polymerase III 12.5 kDa subunit; RNA polymerase III subunit (hRPC11); RNA polymerase III subunit C10; RNA polymerase III subunit C11; RNA polymerase III subunit CII; RPC10; RPC11C11-RNP3; RPC12.5 POLR3K C11, C11-RNP3, My010, RPC10, RPC11, RPC12.5 RNA polymerase III subunit K DNA-directed RNA polymerase III subunit RPC10|DNA-directed RNA polymerase III subunit K|DNA-directed RNA polymerases III 12.5 kDa polypeptide|RNA polymerase III 12.5 kDa subunit|RNA polymerase III subunit C10|RNA polymerase III subunit C11|RNA polymerase III subunit CII|polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa|polymerase (RNA) III subunit K

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on POLR3K, check out the POLR3K Infographic

POLR3K infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for POLR3K: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y2Y1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used POLR3K (NM_016310) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For POLR3K (NM_016310) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for POLR3K (NM_016310) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y2Y1
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.