WDR55 (NM_017706) Human Recombinant Protein

WDR55 protein,

Recombinant protein of human WD repeat domain 55 (WDR55)

Product Info Summary

SKU: PROTQ9H6Y2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

WDR55 (NM_017706) Human Recombinant Protein

View all WDR55 recombinant proteins

SKU/Catalog Number

PROTQ9H6Y2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human WD repeat domain 55 (WDR55)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

WDR55 (NM_017706) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H6Y2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

41.9 kDa

Amino Acid Sequence

MDRTCEERPAEDGSDEEDPDSMEAPTRIRDTPEDIVLEAPASGLAFHPARDLLAAGDVDGDVFVFSYSCQEGETKELWSSGHHLKACRAVAFSEDGQKLITVSKDKAIHVLDVEQGQLERRVSKAHGAPINSLLLVDENVLATGDDTGGIRLWDQRKEGPLMDMRQHEEYIADMALDPAKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACGSSEGTIYLFNWNGFGATSDRFALRAESIDCMVPVTESLLCTGSTDGVIRAVNILPNRVVGSVGQHTGEPVEELALSHCGRFLASSGHDQRLKFWDMAQLRAVVVDDYRRRKKKGGPLRALSSKTWSTDDFFAGLREEGEDSMAQEEKEETGDDSD

Validation Images & Assay Conditions

Gene/Protein Information For WDR55 (Source: Uniprot.org, NCBI)

Gene Name

WDR55

Full Name

WD repeat-containing protein 55

Weight

41.9 kDa

Superfamily

WD repeat WDR55 family

Alternative Names

FLJ20195; FLJ21702; WD repeat domain 55; WD repeat-containing protein 55 WDR55 WD repeat domain 55 WD repeat-containing protein 55

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on WDR55, check out the WDR55 Infographic

WDR55 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for WDR55: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H6Y2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used WDR55 (NM_017706) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For WDR55 (NM_017706) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for WDR55 (NM_017706) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H6Y2
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.