Product Info Summary
SKU: | A04227-1 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-MAdCAM1 Antibody Picoband™
SKU/Catalog Number
A04227-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-MAdCAM1 Antibody Picoband™ catalog # A04227-1. Tested in WB applications. This antibody reacts with Human.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-MAdCAM1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04227-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human MAdCAM1, which shares 61.1% and 52.8% amino acid (aa) sequence identity with mouse and rat MAdCAM1, respectively.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A04227-1 is reactive to MADCAM1 in Human
Applications
A04227-1 is guaranteed for WB Boster Guarantee
Observed Molecular Weight
43 kDa
Calculated molecular weight
Background of MAdCAM-1
MADCAM1 (Mucosal Vascular Addressin Cell Adhesion Molecule 1), also known as MACAM1, is a protein that in humans is encoded by the MADCAM1 gene. By PCR-based analysis of somatic cell hybrids, this gene is mapped to chromosome 19. The protein encoded by this gene is an endothelil cell adhesion molecule that interacts preferentially with the leukocyte beta7 integrin LPAM-1 (alpha4 / beta7), L-selectin, and VLA-4 (alpha4 / beta1) on myeloid cells to direct leukocytes into mucosal and inflamed tissues. It is a member of the immunoglobulin superfamily and is similar to ICAM-1 and VCAM-1.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Validation Images & Assay Conditions
![A04227 1 MAdCAM1 primary antibodies WB testing 1 A04227 1 MAdCAM1 primary antibodies WB testing 1](https://www.bosterbio.com/media/catalog/product/A/0/A04227-1-MAdCAM1-primary-antibodies-WB-testing-1.jpg)
Click image to see more details
Figure 1. Western blot analysis of MAdCAM1 using anti-MAdCAM1 antibody (A04227-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human 293T whole cell lysate,
Lane 2: human A375 whole cell lysate,
Lane 3: human K562 whole cell lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MAdCAM1 antigen affinity purified polyclonal antibody (Catalog # A04227-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for MAdCAM1 at approximately 43KD. The expected band size for MAdCAM1 is at 40KD.
Protein Target Info & Infographic
Gene/Protein Information For MADCAM1 (Source: Uniprot.org, NCBI)
Gene Name
MADCAM1
Full Name
Mucosal addressin cell adhesion molecule 1
Weight
Alternative Names
hMAdCAM-1; MACAM1; MAdCAM1; MAdCAM-1; mucosal addressin cell adhesion molecule 1; mucosal addressin cell adhesion molecule-1; mucosal vascular addressin cell adhesion molecule 1 MADCAM1 MACAM1 mucosal vascular addressin cell adhesion molecule 1 mucosal addressin cell adhesion molecule 1|MAdCAM-1|hMAdCAM-1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on MADCAM1, check out the MADCAM1 Infographic
![MADCAM1 infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for MADCAM1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-MAdCAM1 Antibody Picoband™ (A04227-1)
Hello CJ!
No publications found for A04227-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-MAdCAM1 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-MAdCAM1 Antibody Picoband™
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
13 Customer Q&As for Anti-MAdCAM1 Antibody Picoband™
Question
We are currently using anti-MAdCAM1 antibody A04227-1 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on primate tissues as well?
K. Moore
Verified customer
Asked: 2020-04-16
Answer
The anti-MAdCAM1 antibody (A04227-1) has not been validated for cross reactivity specifically with primate tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-04-16
Question
Is this A04227-1 anti-MAdCAM1 antibody reactive to the isotypes of MADCAM1?
Verified Customer
Verified customer
Asked: 2020-03-31
Answer
The immunogen of A04227-1 anti-MAdCAM1 antibody is A synthetic peptide corresponding to a sequence of human MAdCAM1 (QELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRL). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-03-31
Question
I see that the anti-MAdCAM1 antibody A04227-1 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2020-03-26
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2020-03-26
Question
I am interested in to test anti-MAdCAM1 antibody A04227-1 on human brain for research purposes, then I may be interested in using anti-MAdCAM1 antibody A04227-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-10-04
Answer
The products we sell, including anti-MAdCAM1 antibody A04227-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-10-04
Question
Would A04227-1 anti-MAdCAM1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-05-15
Answer
You can see on the product datasheet, A04227-1 anti-MAdCAM1 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-05-15
Question
Will anti-MAdCAM1 antibody A04227-1 work for WB with brain?
D. Johnson
Verified customer
Asked: 2019-02-08
Answer
According to the expression profile of brain, MADCAM1 is highly expressed in brain. So, it is likely that anti-MAdCAM1 antibody A04227-1 will work for WB with brain.
Boster Scientific Support
Answered: 2019-02-08
Question
I was wanting to use your anti-MAdCAM1 antibody for WB for human brain on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human brain identification?
Verified Customer
Verified customer
Asked: 2019-01-30
Answer
As indicated on the product datasheet, A04227-1 anti-MAdCAM1 antibody has been validated for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human brain in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-01-30
Question
See below the WB image, lot number and protocol we used for brain using anti-MAdCAM1 antibody A04227-1. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-01-29
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-01-29
Question
Do you have a BSA free version of anti-MAdCAM1 antibody A04227-1 available?
Verified Customer
Verified customer
Asked: 2019-01-23
Answer
Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-MAdCAM1 antibody A04227-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-01-23
Question
Does anti-MAdCAM1 antibody A04227-1 work on feline WB with vermiform appendix?
A. Jones
Verified customer
Asked: 2018-04-24
Answer
Our lab technicians have not tested anti-MAdCAM1 antibody A04227-1 on feline. You can run a BLAST between feline and the immunogen sequence of anti-MAdCAM1 antibody A04227-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated feline samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in feline vermiform appendix in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-04-24
Question
Can you help my question with product A04227-1, anti-MAdCAM1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
D. Carter
Verified customer
Asked: 2017-10-23
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A04227-1 anti-MAdCAM1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2017-10-23
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for brain using anti-MAdCAM1 antibody A04227-1. Let me know if you need anything else.
P. Walker
Verified customer
Asked: 2016-07-01
Answer
Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2016-07-01
Question
Is a blocking peptide available for product anti-MAdCAM1 antibody (A04227-1)?
K. Krishna
Verified customer
Asked: 2013-02-08
Answer
We do provide the blocking peptide for product anti-MAdCAM1 antibody (A04227-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2013-02-08