NCOA4 (NM_005437) Human Recombinant Protein

NCOA4 protein,

Recombinant protein of human nuclear receptor coactivator 4 (NCOA4), transcript variant 5

Product Info Summary

SKU: PROTQ13772
Size: 20 µg
Source: HEK293T

Product Name

NCOA4 (NM_005437) Human Recombinant Protein

View all NCOA4 recombinant proteins

SKU/Catalog Number

PROTQ13772

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human nuclear receptor coactivator 4 (NCOA4), transcript variant 5

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NCOA4 (NM_005437) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ13772)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

69.5 kDa

Amino Acid Sequence

MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLFEADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKPASGYQAPYIPSTDPQDWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSSFSIEMEKVGDQELPDQDEMDLSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNCQGNQPKGVEIENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKVEEVCRANEPCTSFAECVCDENCEKEALYKWLLKKEGKDKNGMPVEPKPEPEKHKDSLNMWLCPRKEVIEQTKAPKAMTPSRIADSFQVIKNSPLSEWLIRPPYKEGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM

Validation Images & Assay Conditions

Gene/Protein Information For NCOA4 (Source: Uniprot.org, NCBI)

Gene Name

NCOA4

Full Name

Nuclear receptor coactivator 4

Weight

69.5 kDa

Alternative Names

Androgen receptor coactivator 70 kDa protein; Androgen receptor-associated protein of 70 kDa; ARA70RFGret fused; DKFZp762E1112; ELE1NCoA-4; nuclear receptor coactivator 4,70 kDa AR-activator; PTC3RET-activating gene ELE1; Ret-activating protein ELE1,70 kDa androgen receptor coactivator NCOA4 ARA70, ELE1, PTC3, RFG nuclear receptor coactivator 4 nuclear receptor coactivator 4|70 kDa AR-activator|70 kDa androgen receptor coactivator|NCoA-4|RET-activating gene ELE1|androgen receptor-associated protein of 70 kDa|ret fused

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NCOA4, check out the NCOA4 Infographic

NCOA4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NCOA4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ13772

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NCOA4 (NM_005437) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NCOA4 (NM_005437) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NCOA4 (NM_005437) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ13772
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.