Anti-Cytokeratin 19/KRT19 Antibody Picoband®

Cytokeratin 19 antibody

Boster Bio Anti-Cytokeratin 19/KRT19 Antibody Picoband® catalog # PB9715. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 13 publication(s).

Product Info Summary

SKU: PB9715
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC, ICC, WB

Product Name

Anti-Cytokeratin 19/KRT19 Antibody Picoband®

View all Cytokeratin 19 Antibodies

SKU/Catalog Number

PB9715

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Cytokeratin 19/KRT19 Antibody Picoband® catalog # PB9715. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Cytokeratin 19/KRT19 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9715)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Cytokeratin 19, different from the related mouse and rat sequences by nine amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9715 is reactive to KRT19 in Human, Mouse, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

44 kDa

Calculated molecular weight

44106 MW

Background of Cytokeratin 19

Keratin, type I cytoskeletal 19 is a protein that in humans is encoded by the KRT19 gene. The protein encoded by this gene is a member of the keratin family. It is specifically expressed in the periderm, the transiently superficial layer that envelops the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21. Due to its high sensitivity, KRT19 is the most used marker for the RT-PCR-mediated detection of tumor cells disseminated in lymph nodes, peripheral blood, and bone marrow of breast cancer patients. Keratin 19 is often used together with keratin 8 and keratin 18 to differentiate cells of epithelial origin from hematopoietic cells in tests that enumerate circulating tumor cells in blood.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9715 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Immunofluorescence, 5μg/ml, Human
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human

Positive Control

WB: human placenta tissuehuman MCF-7 whole cell, human SW620 whole cell, human HepG2 whole cell, human PANC-1 whole cell, rat lung tissue, rat small intestine tissue, mouse lung tissue, mouse HEPA1-6 whole cell
IHC: human lung cancer tissue, human lung cancer tissue, human intestinal cancer tissue, mouse small intestine tissue, rat small intestine tissue, human lung cancer tissue
ICC/IF: MCF-7 cell
IF: human colon cancer tissue
FCM: MCF-7 cell

Validation Images & Assay Conditions

Gene/Protein Information For KRT19 (Source: Uniprot.org, NCBI)

Gene Name

KRT19

Full Name

Keratin, type I cytoskeletal 19

Weight

44106 MW

Superfamily

intermediate filament family

Alternative Names

Keratin, type I cytoskeletal 19;Cytokeratin-19;CK-19;Keratin-19;K19;KRT19; KRT19 CK19, K19, K1CS keratin 19 keratin, type I cytoskeletal 19|40-kDa keratin intermediate filament|CK-19|cytokeratin 19|keratin 19, type I|keratin, type I, 40-kd

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on KRT19, check out the KRT19 Infographic

KRT19 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for KRT19: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

PB9715 has been cited in 13 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

MicroRNA-421 mediates immunosensitivity in late-stage human liver cancer

Adult islets cultured in collagen gel transdifferentiate into duct-like cells

Plumbagin Alleviates Capillarization of Hepatic Sinusoids In Vitro by Downregulating ET-1, VEGF, LN, and Type IV Collagen

Matrine promotes hepatic oval cells differentiation into hepatocytes and alleviates liver injury by suppression of Notch signalling pathway

Establishment of a corneal epithelial cell line spontaneously derived from human limbal cells

Shi J,Han G,Wang J,Han X,Zhao M,Duan X,Mi L,Li N,Yin X,Shi H,Li C,Xu J,Yin F.Matrine promotes hepatic oval cells differentiation into hepatocytes and alleviates liver injury by suppression of Notch signalling pathway.Life Sci.2020 Nov 15;261:118354.doi:10.1016/j.lfs.2020.118354.Epub 2020 Aug 28.PMID:32866517.
Species: Human,Rat
PB9715 usage in article: APP:WB, SAMPLE:HOCS, DILUTION:1:1000

Chen H,Kang J,Zhang F,Yan T,Fan W,He H,Huang F.SIRT4 regulates rat dental papilla cell differentiation by promoting mitochondrial functions.Int J Biochem Cell Biol.2021 Feb 23:105962.doi:10.1016/j.biocel.2021.105962.Epub ahead of print.PMID:33636397.
Species: Rat
PB9715 usage in article: APP:IF, SAMPLE:DPCS, DILUTION:1:100

Wu T,Tang C,Chen Y,Yong X,Liu Z,Jiang L,Zeng Q,Tao R.Regulatory effect of 17β-estradiol on the expression of β-defensin-2 and proinflammatory cytokines in human oral epithelial cells.J Oral Pathol Med.2020 Apr;49(4):365-372.doi:10.1111/jop.13016.Epub 2020
Species: Human
PB9715 usage in article: APP:ICC, SAMPLE:HOMECS, DILUTION:1:100

Selective tropism of liver stem cells to hepatocellular carcinoma in vivo.

Quan, J., Du, Q., Hou, Y., Wang, Z., & Zhang, J. (2017). Utilization of E-cadherin by monocytes from tumour cells plays key roles in the progression of bone invasion by oral squamous cell carcinoma. Oncology Reports, 38(2), 850-858. Advance online...

Have you used Anti-Cytokeratin 19/KRT19 Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Cytokeratin 19/KRT19 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-Cytokeratin 19/KRT19 Antibody Picoband®

Question

Is this PB9715 anti-Cytokeratin 19/KRT19 antibody reactive to the isotypes of KRT19?

Verified Customer

Verified customer

Asked: 2020-03-12

Answer

The immunogen of PB9715 anti-Cytokeratin 19/KRT19 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human Cytokeratin 19 (334-372aa QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR), different from the related mouse and rat sequences by nine amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-03-12

Question

My question regarding product PB9715, anti-Cytokeratin 19/KRT19 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2020-03-02

Answer

It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9715 anti-Cytokeratin 19/KRT19 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-03-02

Question

I see that the anti-Cytokeratin 19/KRT19 antibody PB9715 works with IHC, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2020-01-01

Answer

You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2020-01-01

Question

Will PB9715 anti-Cytokeratin 19/KRT19 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-05-22

Answer

It shows on the product datasheet, PB9715 anti-Cytokeratin 19/KRT19 antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-05-22

Question

I was wanting to use your anti-Cytokeratin 19/KRT19 antibody for IHC for human lymph node on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human lymph node identification?

Verified Customer

Verified customer

Asked: 2019-05-14

Answer

You can see on the product datasheet, PB9715 anti-Cytokeratin 19/KRT19 antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human lymph node in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-05-14

Question

I have attached the WB image, lot number and protocol we used for lymph node using anti-Cytokeratin 19/KRT19 antibody PB9715. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-03-22

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-03-22

Question

I would like to test anti-Cytokeratin 19/KRT19 antibody PB9715 on human lymph node for research purposes, then I may be interested in using anti-Cytokeratin 19/KRT19 antibody PB9715 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-03-18

Answer

The products we sell, including anti-Cytokeratin 19/KRT19 antibody PB9715, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-03-18

Question

We are currently using anti-Cytokeratin 19/KRT19 antibody PB9715 for rat tissue, and we are satisfied with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2019-02-01

Answer

The anti-Cytokeratin 19/KRT19 antibody (PB9715) has not been validated for cross reactivity specifically with dog tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-02-01

Question

I would like using your anti-Cytokeratin 19/KRT19 antibody for keratinization studies. Has this antibody been tested with western blotting on sw620 whole cell lysates? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2018-10-10

Answer

Thank you for your inquiry. This PB9715 anti-Cytokeratin 19/KRT19 antibody is tested on human placenta tissue, lung tissue, intestine tissue, mouse lung tissue, small intestine tissue, rat lung tissue, sw620 whole cell lysates, hepg2 whole cell lysates. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2018-10-10

Question

We have tried in the past anti-Cytokeratin 19/KRT19 antibody for IHC on keratinocyte in a previous experiment. I am using mouse, and I plan to use the antibody for WB next. I am looking for examining keratinocyte as well as lymph node in our next experiment. Could you please give me some suggestion on which antibody would work the best for WB?

Verified Customer

Verified customer

Asked: 2018-08-27

Answer

I looked at the website and datasheets of our anti-Cytokeratin 19/KRT19 antibody and it seems that PB9715 has been validated on mouse in both IHC and WB. Thus PB9715 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2018-08-27

Question

Will anti-Cytokeratin 19/KRT19 antibody PB9715 work for IHC with lymph node?

B. Dhar

Verified customer

Asked: 2018-05-18

Answer

According to the expression profile of lymph node, KRT19 is highly expressed in lymph node. So, it is likely that anti-Cytokeratin 19/KRT19 antibody PB9715 will work for IHC with lymph node.

Boster Scientific Support

Answered: 2018-05-18

Question

Do you have a BSA free version of anti-Cytokeratin 19/KRT19 antibody PB9715 available?

Verified Customer

Verified customer

Asked: 2017-09-19

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Cytokeratin 19/KRT19 antibody PB9715 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2017-09-19

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for lymph node using anti-Cytokeratin 19/KRT19 antibody PB9715. Let me know if you need anything else.

A. Li

Verified customer

Asked: 2017-05-30

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2017-05-30

Question

We have seen staining in mouse keratinocyte. Are there any suggestions? Is anti-Cytokeratin 19/KRT19 antibody supposed to stain keratinocyte positively?

E. Jackson

Verified customer

Asked: 2017-05-08

Answer

According to literature keratinocyte does express KRT19. According to Uniprot.org, KRT19 is expressed in lower esophagus mucosa, placenta, mammary gland, pancreas placenta, peripheral blood leukocyte, keratinocyte, lymph node, cervix carcinoma erythroleukemia, colon carcinoma, among other tissues. Regarding which tissues have KRT19 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Colon carcinoma, Pubmed ID: 24129315
Keratinocyte, Pubmed ID: 1286667
Lymph node, Pubmed ID: 10212274
Mammary gland, Pancreas, and Placenta, Pubmed ID: 15489334
Peripheral blood leukocyte, Pubmed ID: 11682035
Placenta, Pubmed ID: 2447559, 2469734, 14702039

Boster Scientific Support

Answered: 2017-05-08

Question

Is a blocking peptide available for product anti-Cytokeratin 19/KRT19 antibody (PB9715)?

G. Roberts

Verified customer

Asked: 2016-03-10

Answer

We do provide the blocking peptide for product anti-Cytokeratin 19/KRT19 antibody (PB9715). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2016-03-10

Order DetailsPrice
PB9715

100μg

$370
PB9715-10ug

10μg sample (liquid)

$99
PB9715-Biotin

100 μg Biotin conjugated

$570
PB9715-Cy3

100 μg Cy3 conjugated

$570
PB9715-Dylight488

100 μg Dylight488 conjugated

$570
PB9715-Dylight550

100 μg Dylight550 conjugated

$570
PB9715-Dylight594

100 μg Dylight594 conjugated

$570
PB9715-FITC

100 μg FITC conjugated

$570
PB9715-HRP

100 μg HRP conjugated

$570
PB9715-APC

100 μg APC conjugated

$670
PB9715-PE

100 μg PE conjugated

$670
PB9715-iFluor647

100 μg iFluor647 conjugated

$670
PB9715-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9715
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.