MSMB (NM_002443) Human Recombinant Protein

PSP94/MSMB protein,

Product Info Summary

SKU: PROTP08118
Size: 20 µg
Source: HEK293T

Product Name

MSMB (NM_002443) Human Recombinant Protein

View all PSP94/MSMB recombinant proteins

SKU/Catalog Number

PROTP08118

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human microseminoprotein, beta- (MSMB), transcript variant PSP94

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MSMB (NM_002443) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP08118)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

10.7 kDa

Amino Acid Sequence

MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII

Validation Images & Assay Conditions

Gene/Protein Information For MSMB (Source: Uniprot.org, NCBI)

Gene Name

MSMB

Full Name

Beta-microseminoprotein

Weight

10.7 kDa

Superfamily

beta-microseminoprotein family

Alternative Names

IGBF; MSMB; MSPB; PIP; PN44; PRPS; PSP57; PSP94 MSMB HPC13, IGBF, MSP, MSPB, PN44, PRPS, PSP, PSP-94, PSP57, PSP94 microseminoprotein beta beta-microseminoprotein|immunoglobulin binding factor|prostate secreted seminal plasma protein|prostate secretory protein of 94 amino acids|seminal plasma beta-inhibin

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MSMB, check out the MSMB Infographic

MSMB infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MSMB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP08118

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MSMB (NM_002443) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MSMB (NM_002443) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MSMB (NM_002443) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP08118
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.