Growth Hormone (GH1) (NM_022559) Human Recombinant Protein

Growth Hormone protein,

Product Info Summary

SKU: PROTP01241
Size: 20 µg
Source: HEK293T

Product Name

Growth Hormone (GH1) (NM_022559) Human Recombinant Protein

View all Growth Hormone recombinant proteins

SKU/Catalog Number

PROTP01241

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human growth hormone 1 (GH1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Growth Hormone (GH1) (NM_022559) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP01241)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.8 kDa

Amino Acid Sequence

MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

Validation Images & Assay Conditions

Gene/Protein Information For GH1 (Source: Uniprot.org, NCBI)

Gene Name

GH1

Full Name

Somatotropin

Weight

22.8 kDa

Superfamily

somatotropin/prolactin family

Alternative Names

GH1; GHB5; GHIGHD1B; GHN; GH-N; GHNGrowth hormone; GH-Nsomatotropin; growth hormone 1Pituitary growth hormone; Growth Hormone; hGH-N; IGHD1A; IGHD2; Somatotropin GH1 GH, GH-N, GHB5, GHN, IGHD1A, IGHD1B, IGHD2, hGH-N growth hormone 1 somatotropin|growth hormone B5|pituitary growth hormone

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GH1, check out the GH1 Infographic

GH1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GH1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP01241

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Growth Hormone (GH1) (NM_022559) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Growth Hormone (GH1) (NM_022559) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Growth Hormone (GH1) (NM_022559) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP01241
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.