FLT1-D3 Vascular Endothelial Growth Factor Receptor-1 D3 Human Recombinant Protein

VEGFR1/Flt-1 protein, Human

FLT1 D1-3 Human Recombinant produced in baculovirus is monomeric, glycosylated, polypeptide containing 327 amino acids and having a molecular mass of 45 kDa. The soluble receptor protein contains only the first 3 extracellular domains, which contain all the information necessary for binding of VEGF. The FLT1 is purified by proprietary chromatographic techniques.

Product Info Summary

SKU: PROTP17948
Size: 2ug, 10ug, 100ug
Origin Species: Human
Source: Insect cells

Product Name

FLT1-D3 Vascular Endothelial Growth Factor Receptor-1 D3 Human Recombinant Protein

View all VEGFR1/Flt-1 recombinant proteins

SKU/Catalog Number

PROTP17948

Size

2ug, 10ug, 100ug

Description

FLT1 D1-3 Human Recombinant produced in baculovirus is monomeric, glycosylated, polypeptide containing 327 amino acids and having a molecular mass of 45 kDa. The soluble receptor protein contains only the first 3 extracellular domains, which contain all the information necessary for binding of VEGF. The FLT1 is purified by proprietary chromatographic techniques.

Storage & Handling

Lyophilized FLT-1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FLT1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Cite This Product

FLT1-D3 Vascular Endothelial Growth Factor Receptor-1 D3 Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP17948)

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

FLT1 D1-3 was lyophilized from a concentrated (1mg/ml) sterile solution containing 1xPBS.

Purity

Greater than 90.0% as determined by SDS-PAGE.

Predicted MW

150.769kDa

Reconstitution

It is recommended to reconstitute the lyophilized FLT1 D3 in sterile water not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Amino Acid Sequence

SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSI TKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYI FISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDT LIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQT NTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRA SVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSV HIYDKAFITVKHRKQQVLETVAGKRSY

Biological Activity

The activity of FLT1D1-3 was determined by its ability to inhibit the VEGF-165-induced proliferation of HUVE cells.

Reconstitution

It is recommended to reconstitute the lyophilized FLT1 D3 in sterile water not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Validation Images & Assay Conditions

Gene/Protein Information For FLT1 (Source: Uniprot.org, NCBI)

Gene Name

FLT1

Full Name

Vascular endothelial growth factor receptor 1

Weight

150.769kDa

Superfamily

protein kinase superfamily

Alternative Names

FLT-1; FLT1; Tyrosine-protein kinase receptor FLT; Flt-1; Tyrosine-protein kinase FRT; Fms-like tyrosine kinase 1; VEGFR-1 FLT1 FLT, FLT-1, VEGFR-1, VEGFR1 fms related receptor tyrosine kinase 1 vascular endothelial growth factor receptor 1|fms related tyrosine kinase 1|fms-like tyrosine kinase 1|fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor)|tyrosine-protein kinase FRT|tyrosine-protein kinase receptor FLT|vascular permeability factor receptor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FLT1, check out the FLT1 Infographic

FLT1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FLT1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP17948

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FLT1-D3 Vascular Endothelial Growth Factor Receptor-1 D3 Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FLT1-D3 Vascular Endothelial Growth Factor Receptor-1 D3 Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FLT1-D3 Vascular Endothelial Growth Factor Receptor-1 D3 Human Recombinant Protein

Size

Total: $250

SKU:PROTP17948

Backordered.

Lead time for this item is typically 10-14 days

Get A Quote
In stock
Order Product
PROTP17948
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.