Product Info Summary
SKU: | PROTP17948 |
---|---|
Size: | 2ug, 10ug, 100ug |
Origin Species: | Human |
Source: | Insect cells |
Customers Who Bought This Also Bought
Product info
Product Name
FLT1-D3 Vascular Endothelial Growth Factor Receptor-1 D3 Human Recombinant Protein
View all VEGFR1/Flt-1 recombinant proteins
SKU/Catalog Number
PROTP17948
Size
2ug, 10ug, 100ug
Description
FLT1 D1-3 Human Recombinant produced in baculovirus is monomeric, glycosylated, polypeptide containing 327 amino acids and having a molecular mass of 45 kDa. The soluble receptor protein contains only the first 3 extracellular domains, which contain all the information necessary for binding of VEGF. The FLT1 is purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized FLT-1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FLT1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Cite This Product
FLT1-D3 Vascular Endothelial Growth Factor Receptor-1 D3 Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP17948)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
FLT1 D1-3 was lyophilized from a concentrated (1mg/ml) sterile solution containing 1xPBS.
Purity
Greater than 90.0% as determined by SDS-PAGE.
Predicted MW
150.769kDa
Reconstitution
It is recommended to reconstitute the lyophilized FLT1 D3 in sterile water not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Amino Acid Sequence
SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSI TKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYI FISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDT LIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQT NTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRA SVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSV HIYDKAFITVKHRKQQVLETVAGKRSY
Biological Activity
The activity of FLT1D1-3 was determined by its ability to inhibit the VEGF-165-induced proliferation of HUVE cells.
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized FLT1 D3 in sterile water not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For FLT1 (Source: Uniprot.org, NCBI)
Gene Name
FLT1
Full Name
Vascular endothelial growth factor receptor 1
Weight
150.769kDa
Superfamily
protein kinase superfamily
Alternative Names
FLT-1; FLT1; Tyrosine-protein kinase receptor FLT; Flt-1; Tyrosine-protein kinase FRT; Fms-like tyrosine kinase 1; VEGFR-1 FLT1 FLT, FLT-1, VEGFR-1, VEGFR1 fms related receptor tyrosine kinase 1 vascular endothelial growth factor receptor 1|fms related tyrosine kinase 1|fms-like tyrosine kinase 1|fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor)|tyrosine-protein kinase FRT|tyrosine-protein kinase receptor FLT|vascular permeability factor receptor
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on FLT1, check out the FLT1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for FLT1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For FLT1-D3 Vascular Endothelial Growth Factor Receptor-1 D3 Human Recombinant Protein (PROTP17948)
Hello CJ!
No publications found for PROTP17948
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used FLT1-D3 Vascular Endothelial Growth Factor Receptor-1 D3 Human Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For FLT1-D3 Vascular Endothelial Growth Factor Receptor-1 D3 Human Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question