FLIP (CFLAR) (NM_001127184) Human Recombinant Protein

FLIP protein,

Product Info Summary

SKU: PROTO15519
Size: 20 µg
Source: HEK293T

Product Name

FLIP (CFLAR) (NM_001127184) Human Recombinant Protein

View all FLIP recombinant proteins

SKU/Catalog Number

PROTO15519

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human CASP8 and FADD-like apoptosis regulator (CFLAR), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FLIP (CFLAR) (NM_001127184) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO15519)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.2 kDa

Amino Acid Sequence

MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRMITPYAHCPDLKILGNCSM

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For CFLAR (Source: Uniprot.org, NCBI)

Gene Name

CFLAR

Full Name

CASP8 and FADD-like apoptosis regulator

Weight

25.2 kDa

Superfamily

peptidase C14A family

Alternative Names

CASHFADD-like antiapoptotic molecule 1; CASP8 and FADD-like apoptosis regulator; CASP8AP1; Caspase homolog; Caspase-eight-related protein; Caspase-like apoptosis regulatory protein; caspase-related inducer of apoptosis; CASPER; CasperFLAME1; Cellular FLICE-like inhibitory protein; CFLAR; c-FLIPR; c-FLIPS; CLARPMACH-related inducer of toxicity; FADD-like apoptotic molecule; FLAME; FLAME-1; FLIP; I-FLICE; I-FLICEMRITc-FLIPFLIPc-FLIPL; Inhibitor of FLICE; usurpin beta; Usurpin CFLAR CASH, CASP8AP1, CLARP, Casper, FLAME, FLAME-1, FLAME1, FLIP, I-FLICE, MRIT, c-FLIP, c-FLIPL, c-FLIPR, c-FLIPS, cFLIP CASP8 and FADD like apoptosis regulator CASP8 and FADD-like apoptosis regulator|FADD-like antiapoptotic molecule 1|MACH-related inducer of toxicity|caspase homolog|caspase-eight-related protein|caspase-like apoptosis regulatory protein|caspase-related inducer of apoptosis|cellular FLICE-like inhibitory protein|inhibitor of FLICE|testis secretory sperm-binding protein Li 233m|usurpin beta

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CFLAR, check out the CFLAR Infographic

CFLAR infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CFLAR: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO15519

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FLIP (CFLAR) (NM_001127184) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FLIP (CFLAR) (NM_001127184) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FLIP (CFLAR) (NM_001127184) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO15519
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.