CD34 (NM_001025109) Human Recombinant Protein

CD34 protein,

Product Info Summary

SKU: PROTP28906
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CD34 (NM_001025109) Human Recombinant Protein

View all CD34 recombinant proteins

SKU/Catalog Number

PROTP28906

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human CD34 molecule (CD34), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CD34 (NM_001025109) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP28906)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

40.5 kDa

Amino Acid Sequence

MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL

Validation Images & Assay Conditions

Gene/Protein Information For CD34 (Source: Uniprot.org, NCBI)

Gene Name

CD34

Full Name

Hematopoietic progenitor cell antigen CD34

Weight

40.5 kDa

Superfamily

CD34 family

Alternative Names

CD34 antigenhematopoietic progenitor cell antigen CD34; CD34 molecule; CD34; HPCA1 CD34 CD34 molecule hematopoietic progenitor cell antigen CD34|CD34 antigen

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CD34, check out the CD34 Infographic

CD34 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CD34: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP28906

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CD34 (NM_001025109) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CD34 (NM_001025109) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CD34 (NM_001025109) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP28906
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.