Click image to see more details
Product Info Summary
| SKU: | PB9644 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-ING1 Antibody Picoband®
SKU/Catalog Number
PB9644
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-ING1 Antibody Picoband® catalog # PB9644. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-ING1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9644)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human ING1, different from the related mouse sequence by seven amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9644 is reactive to ING1 in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
47 kDa
Calculated molecular weight
46738 MW
Background of ING1
Inhibitor of growth protein 1 is a protein that in humans is encoded by the ING1 gene. It is mapped to 13q34. This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9644 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Positive Control
WB: HELA Whole Cell, A549 Whole Cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of ING1 using anti-ING1 antibody (PB9644).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours.
Lane 1: HELA Whole Cell Lysate at 40ug,
Lane 2: A549 Whole Cell Lysate at 40ug.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ING1 antigen affinity purified polyclonal antibody (Catalog # PB9644) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for ING1 at approximately 47 kDa. The expected band size for ING1 is at 47 kDa.
Protein Target Info & Infographic
Gene/Protein Information For ING1 (Source: Uniprot.org, NCBI)
Gene Name
ING1
Full Name
Inhibitor of growth protein 1
Weight
46738 MW
Superfamily
ING family
Alternative Names
Inhibitor of growth protein 1;ING1; ING1 p24ING1c, p33, p33ING1, p33ING1b, p47, p47ING1a inhibitor of growth family member 1 inhibitor of growth protein 1|growth inhibitor ING1|growth inhibitory protein ING1|tumor suppressor ING1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on ING1, check out the ING1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for ING1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-ING1 Antibody Picoband® (PB9644)
Hello CJ!
No publications found for PB9644
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-ING1 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-ING1 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
2 Customer Q&As for Anti-ING1 Antibody Picoband®
Question
Is this PB9644 anti-ING1 antibody reactive to the isotypes of ING1?
Verified Customer
Verified customer
Asked: 2020-02-04
Answer
The immunogen of PB9644 anti-ING1 antibody is A synthetic peptide corresponding to a sequence in the middle region of human ING1 (192-223aa KELDECYERFSRETDGAQKRRMLHCVQRALIR), different from the related mouse sequence by seven amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-02-04
Question
We are currently using anti-ING1 antibody PB9644 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on goat tissues as well?
Verified Customer
Verified customer
Asked: 2017-08-08
Answer
The anti-ING1 antibody (PB9644) has not been validated for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2017-08-08
