Anti-ING1 Antibody Picoband™

ING1 antibody

Boster Bio Anti-ING1 Antibody Picoband™ catalog # PB9644. Tested in WB applications. This antibody reacts with Human.

Product Info Summary

SKU: PB9644
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Product Name

Anti-ING1 Antibody Picoband™

View all ING1 Antibodies

SKU/Catalog Number

PB9644

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-ING1 Antibody Picoband™ catalog # PB9644. Tested in WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-ING1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9644)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human ING1, different from the related mouse sequence by seven amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9644 is reactive to ING1 in Human

Applications

PB9644 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

47 kDa

Calculated molecular weight

46738 MW

Background of ING1

Inhibitor of growth protein 1 is a protein that in humans is encoded by the ING1 gene. It is mapped to 13q34. This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For ING1 (Source: Uniprot.org, NCBI)

Gene Name

ING1

Full Name

Inhibitor of growth protein 1

Weight

46738 MW

Superfamily

ING family

Alternative Names

growth inhibitor ING1; growth inhibitory protein ING1; ING1; inhibitor of growth family, member 1; inhibitor of growth protein 1; p24ING1c; p33; p33ING1; p33ING1b; p47; p47ING1a; tumor suppressor ING1 ING1 p24ING1c, p33, p33ING1, p33ING1b, p47, p47ING1a inhibitor of growth family member 1 inhibitor of growth protein 1|growth inhibitor ING1|growth inhibitory protein ING1|tumor suppressor ING1

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on ING1, check out the ING1 Infographic

ING1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ING1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB9644

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-ING1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-ING1 Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

2 Customer Q&As for Anti-ING1 Antibody Picoband™

Question

Is this PB9644 anti-ING1 antibody reactive to the isotypes of ING1?

Verified Customer

Verified customer

Asked: 2020-02-04

Answer

The immunogen of PB9644 anti-ING1 antibody is A synthetic peptide corresponding to a sequence in the middle region of human ING1 (192-223aa KELDECYERFSRETDGAQKRRMLHCVQRALIR), different from the related mouse sequence by seven amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-02-04

Question

We are currently using anti-ING1 antibody PB9644 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on goat tissues as well?

Verified Customer

Verified customer

Asked: 2017-08-08

Answer

The anti-ING1 antibody (PB9644) has not been validated for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2017-08-08

Order DetailsPrice
PB9644

100μg

$370
PB9644-10ug

10μg sample (liquid)

$99
PB9644-Biotin

100 μg Biotin conjugated

$570
PB9644-Cy3

100 μg Cy3 conjugated

$570
PB9644-Dylight488

100 μg Dylight488 conjugated

$570
PB9644-Dylight550

100 μg Dylight550 conjugated

$570
PB9644-Dylight594

100 μg Dylight594 conjugated

$570
PB9644-FITC

100 μg FITC conjugated

$570
PB9644-HRP

100 μg HRP conjugated

$570
PB9644-APC

100 μg APC conjugated

$670
PB9644-PE

100 μg PE conjugated

$670
PB9644-iFluor647

100 μg iFluor647 conjugated

$670
PB9644-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9644
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.