ING1 (NM_198219) Human Recombinant Protein

ING1 protein,

Product Info Summary

SKU: PROTQ9UK53
Size: 20 µg
Source: HEK293T

Product Name

ING1 (NM_198219) Human Recombinant Protein

View all ING1 recombinant proteins

SKU/Catalog Number

PROTQ9UK53

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human inhibitor of growth family, member 1 (ING1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ING1 (NM_198219) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UK53)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

31.7 kDa

Amino Acid Sequence

MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR

Validation Images & Assay Conditions

Gene/Protein Information For ING1 (Source: Uniprot.org, NCBI)

Gene Name

ING1

Full Name

Inhibitor of growth protein 1

Weight

31.7 kDa

Superfamily

ING family

Alternative Names

growth inhibitor ING1; growth inhibitory protein ING1; ING1; inhibitor of growth family, member 1; inhibitor of growth protein 1; p24ING1c; p33; p33ING1; p33ING1b; p47; p47ING1a; tumor suppressor ING1 ING1 p24ING1c, p33, p33ING1, p33ING1b, p47, p47ING1a inhibitor of growth family member 1 inhibitor of growth protein 1|growth inhibitor ING1|growth inhibitory protein ING1|tumor suppressor ING1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ING1, check out the ING1 Infographic

ING1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ING1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UK53

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ING1 (NM_198219) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ING1 (NM_198219) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ING1 (NM_198219) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UK53
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.