Click image to see more details
Product Info Summary
| SKU: | A00183-Dyl550 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | Flow Cytometry |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Human Bax DyLight® 550 conjugated Antibody
SKU/Catalog Number
A00183-Dyl550
Size
100 μg/vial
Form
Liquid
Description
Boster Bio Anti-Human Bax DyLight® 550 conjugated Antibody catalog # A00183-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.
Storage & Handling
At -20°C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.
Cite This Product
Anti-Human Bax DyLight® 550 conjugated Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00183-Dyl550)
Host
Rabbit
Contents
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Bax, different from the related mouse and rat sequences by five amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00183-Dyl550 is reactive to BAX in Human
Reconstitution
Observed Molecular Weight
39 kDa
Calculated molecular weight
21.184kDa
Background of BAX
Apoptosis regulator BAX, also known as bcl-2-like protein 4, is a protein that in humans is encoded by the BAX gene. The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. Additionally, this protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00183-Dyl550 is guaranteed for Flow Cytometry Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Flow Cytometry (Fixed), 1-3μg/1x106 cells
Validation Images & Assay Conditions
Click image to see more details
Boster Kit Box
Protein Target Info & Infographic
Gene/Protein Information For BAX (Source: Uniprot.org, NCBI)
Gene Name
BAX
Full Name
Apoptosis regulator BAX
Weight
21.184kDa
Superfamily
Bcl-2 family
Alternative Names
Apoptosis regulator BAX; Bcl-2-like protein 4; Bcl2-L-4; BAX; BCL2L4 BAX BCL2L4 BCL2 associated X, apoptosis regulator apoptosis regulator BAX|BCL2 associated X protein|BCL2-associated X protein omega|Baxdelta2G9|Baxdelta2G9omega|Baxdelta2omega|bcl-2-like protein 4|bcl2-L-4
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on BAX, check out the BAX Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for BAX: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Human Bax DyLight® 550 conjugated Antibody (A00183-Dyl550)
Hello CJ!
A00183-Dyl550 has been cited in 7 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Newcastle disease virus V protein inhibits apoptosis in DF-1 cells by downregulating TXNL1
The Effects of Fasudil at Different Doses on Acute Myocardial Infarction in Rats
Knockdown of High Mobility Group-Box 3 (HMGB3) Expression Inhibits Proliferation, Reduces Migration, and Affects Chemosensitivity in Gastric Cancer Cells
Fenofibrate, a PPAR? agonist, protect proximal tubular cells from albumin-bound fatty acids induced apoptosis via the activation of NF-kB
Sun Y, Xu Hj, Zhao Yx, Wang Lz, Sun Lr, Wang Z, Sun Xf. Evid Based Complement Alternat Med. 2013;2013:690164. Doi: 10.1155/2013/690164. Epub 2013 Mar 19. Crocin Exhibits Antitumor Effects On Human Leukemia Hl-60 Cells In Vitro And In Vivo.
Rasul A, Yu B, Zhong L, Khan M, Yang H, Ma T. Oncol Rep. 2012 May;27(5):1481-7. Doi: 10.3892/Or.2012.1694. Epub 2012 Feb 21. Cytotoxic Effect Of Evodiamine In Sgc-7901 Human Gastric Adenocarcinoma Cells Via Simultaneous Induction Of Ap...
Qin R, Shen H, Cao Y, Fang Y, Li H, Chen Q, Xu W. Plos One. 2013 Oct 1;8(10):E76486. Doi: 10.1371/Journal.Pone.0076486. Ecollection 2013. Tetrandrine Induces Mitochondria-Mediated Apoptosis In Human Gastric Cancer Bgc-823 Cells.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Human Bax DyLight® 550 conjugated Antibody?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Human Bax DyLight® 550 conjugated Antibody
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
14 Customer Q&As for Anti-Human Bax DyLight® 550 conjugated Antibody
Question
Will anti-Human Bax DyLight® 550 conjugated antibody A00183-Dyl550 work for Flow Cytometry with mucosa of transverse colon?
Verified Customer
Verified customer
Asked: 2020-03-24
Answer
According to the expression profile of mucosa of transverse colon, BAX is highly expressed in mucosa of transverse colon. So, it is likely that anti-Human Bax DyLight® 550 conjugated antibody A00183-Dyl550 will work for Flow Cytometry with mucosa of transverse colon.
Boster Scientific Support
Answered: 2020-03-24
Question
Does A00183-Dyl550 anti-Human Bax DyLight® 550 conjugated antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-01-01
Answer
It shows on the product datasheet, A00183-Dyl550 anti-Human Bax DyLight® 550 conjugated antibody as been tested on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-01-01
Question
Is this A00183-Dyl550 anti-Human Bax DyLight® 550 conjugated antibody reactive to the isotypes of BAX?
Verified Customer
Verified customer
Asked: 2019-11-29
Answer
The immunogen of A00183-Dyl550 anti-Human Bax DyLight® 550 conjugated antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17-48aa EQIMKTGALLLQGFIQDRAGRMGGEAPELALD), different from the related mouse and rat sequences by five amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-11-29
Question
I see that the anti-Human Bax DyLight® 550 conjugated antibody A00183-Dyl550 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-09-05
Answer
You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-09-05
Question
My question regarding product A00183-Dyl550, anti-Human Bax DyLight® 550 conjugated antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-07-26
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00183-Dyl550 anti-Human Bax DyLight® 550 conjugated antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-07-26
Question
We are currently using anti-Human Bax DyLight® 550 conjugated antibody A00183-Dyl550 for human tissue, and we are well pleased with the Flow Cytometry results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on goat tissues as well?
Verified Customer
Verified customer
Asked: 2019-06-28
Answer
The anti-Human Bax DyLight® 550 conjugated antibody (A00183-Dyl550) has not been validated for cross reactivity specifically with goat tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-06-28
Question
I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for mucosa of transverse colon using anti-Human Bax DyLight® 550 conjugated antibody A00183-Dyl550. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-04-17
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-04-17
Question
See attached the WB image, lot number and protocol we used for mucosa of transverse colon using anti-Human Bax DyLight® 550 conjugated antibody A00183-Dyl550. Please let me know if you require anything else.
C. Anderson
Verified customer
Asked: 2019-02-22
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-02-22
Question
We have been able to see staining in human b-cell. Any tips? Is anti-Human Bax DyLight® 550 conjugated antibody supposed to stain b-cell positively?
L. Kulkarni
Verified customer
Asked: 2019-01-03
Answer
From literature b-cell does express BAX. From Uniprot.org, BAX is expressed in mucosa of transverse colon, b-cell, brain, ovarian carcinoma, skin, among other tissues. Regarding which tissues have BAX expression, here are a few articles citing expression in various tissues:
B-cell, Pubmed ID: 8358790
Brain, Pubmed ID: 9920818
Ovarian carcinoma, Pubmed ID: 14702039
Skin, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2019-01-03
Question
Is there a BSA free version of anti-Human Bax DyLight® 550 conjugated antibody A00183-Dyl550 available?
Verified Customer
Verified customer
Asked: 2018-09-06
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Human Bax DyLight® 550 conjugated antibody A00183-Dyl550 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2018-09-06
Question
Is a blocking peptide available for product anti-Human Bax DyLight® 550 conjugated antibody (A00183-Dyl550)?
Verified Customer
Verified customer
Asked: 2018-08-22
Answer
We do provide the blocking peptide for product anti-Human Bax DyLight® 550 conjugated antibody (A00183-Dyl550). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2018-08-22
Question
I am interested in to test anti-Human Bax DyLight® 550 conjugated antibody A00183-Dyl550 on human mucosa of transverse colon for research purposes, then I may be interested in using anti-Human Bax DyLight® 550 conjugated antibody A00183-Dyl550 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2018-02-12
Answer
The products we sell, including anti-Human Bax DyLight® 550 conjugated antibody A00183-Dyl550, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-02-12
Question
I was wanting to use your anti-Human Bax DyLight® 550 conjugated antibody for Flow Cytometry for human mucosa of transverse colon on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human mucosa of transverse colon identification?
K. Roberts
Verified customer
Asked: 2013-10-28
Answer
As indicated on the product datasheet, A00183-Dyl550 anti-Human Bax DyLight® 550 conjugated antibody has been validated for Flow Cytometry on human tissues. We have an innovator award program that if you test this antibody and show it works in human mucosa of transverse colon in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2013-10-28
Question
Our lab were content with the WB result of your anti-Human Bax DyLight® 550 conjugated antibody. However we have observed positive staining in mucosa of transverse colon isoform gamma: cytoplasm. using this antibody. Is that expected? Could you tell me where is BAX supposed to be expressed?
T. Mangal
Verified customer
Asked: 2013-09-12
Answer
From literature, mucosa of transverse colon does express BAX. Generally BAX expresses in isoform alpha: mitochondrion outer membrane, isoform beta: cytoplasm., isoform gamma: cytoplasm., isoform delta: cytoplasm. Regarding which tissues have BAX expression, here are a few articles citing expression in various tissues:
B-cell, Pubmed ID: 8358790
Brain, Pubmed ID: 9920818
Ovarian carcinoma, Pubmed ID: 14702039
Skin, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2013-09-12
