Anti-AIF/AIFM1 Antibody Picoband®

AIF antibody

Boster Bio Anti-AIF/AIFM1 Antibody Picoband® catalog # PB9366. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 4 publication(s).

Product Info Summary

SKU: PB9366
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC, ICC, WB

Product Name

Anti-AIF/AIFM1 Antibody Picoband®

View all AIF Antibodies

SKU/Catalog Number

PB9366

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-AIF/AIFM1 Antibody Picoband® catalog # PB9366. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-AIF/AIFM1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9366)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human AIF, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB9366 is reactive to AIFM1 in Human, Mouse, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

67 kDa

Calculated molecular weight

66901 MW

Background of AIF

Apoptosis-inducing factor 1, mitochondrial, also known as AIF or PDCD8 is a protein that in humans is encoded by the AIFM1 gene. AIFM1 gene is mapped to Xq26.1 based on an alignment of the AIFM1 sequence with the genomic sequence. This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, and it is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Mutations in this gene cause combined oxidative phosphorylation deficiency 6, which results in a severe mitochondrial encephalomyopathy. A related pseudogene has been identified on chromosome 10.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9366 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, By Heat
Immunocytochemistry, 0.5-1μg/ml
Immunocytochemistry/Immunofluorescence, 2μg/ml
Flow Cytometry (Fixed), 1-3μg/1x106 cells

Positive Control

WB: human MCF-7 whole cell, human K562 whole cell, human A549 whole cell, human HepG2 whole cell, human Hela whole cell, human Jurkat whole cell, human 293T whole cell, human U251 whole cell, rat stomach tissue, rat kidney tissue, rat NRK whole cell, mouse stomach tissue, mouse kidney tissue, mouse pancreas tissue, mouse NIH/3T3 whole cell,
IHC: Rat Cardiac Muscle tissue, Human Intestinal Cancer tissue, Mouse Cardiac Muscle tissue
ICC/IF: NIH3T3 cell, MCF-7 cell
ICC: SMMC-7721 cell
FCM: Hela cell

Validation Images & Assay Conditions

Gene/Protein Information For AIFM1 (Source: Uniprot.org, NCBI)

Gene Name

AIFM1

Full Name

Apoptosis-inducing factor 1, mitochondrial

Weight

66901 MW

Superfamily

FAD-dependent oxidoreductase family

Alternative Names

Apoptosis-inducing factor 1, mitochondrial;1.1.1.-;Programmed cell death protein 8;AIFM1;AIF, PDCD8; AIFM1 AIF, AUNX1, CMT2D, CMTX4, COWCK, COXPD6, DFNX5, NADMR, NAMSD, PDCD8, SEMDHL apoptosis inducing factor mitochondria associated 1 apoptosis-inducing factor 1, mitochondrial|apoptosis-inducing factor, mitochondrion-associated, 1|auditory neuropathy, X-linked recessive 1|programmed cell death 8 (apoptosis-inducing factor)|striatal apoptosis-inducing factor|testicular secretory protein Li 4

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on AIFM1, check out the AIFM1 Infographic

AIFM1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for AIFM1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

PB9366 has been cited in 4 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Protection by bicyclol derivatives against acetaminophen‐induced acute liver failure in mice and its active mechanism

Icariin induces apoptosis in acute promyelocytic leukemia by targeting PIM1

Wnt5a Increases Properties of Lung Cancer Stem Cells and Resistance to Cisplatin through Activation of Wnt5a/PKC Signaling Pathway

Mechanism of apoptosis induction in human hepatocellular carcinoma cells following treatment with a gecko peptides mixture

Have you used Anti-AIF/AIFM1 Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-AIF/AIFM1 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-AIF/AIFM1 Antibody Picoband®

Question

Is this PB9366 anti-AIF/AIFM1 antibody reactive to the isotypes of AIFM1?

Verified Customer

Verified customer

Asked: 2020-04-20

Answer

The immunogen of PB9366 anti-AIF/AIFM1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human AIF(582-613aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-04-20

Question

Here is the WB image, lot number and protocol we used for cervix carcinoma using anti-AIF/AIFM1 antibody PB9366. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2020-04-10

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-04-10

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for cervix carcinoma using anti-AIF/AIFM1 antibody PB9366. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2020-04-02

Answer

I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-04-02

Question

We ordered your anti-AIF/AIFM1 antibody for WB on cervix carcinoma erythroleukemia in a previous project. I am using human, and We are going to use the antibody for IHC-P next. Our lab want to know about examining cervix carcinoma erythroleukemia as well as apex of heart in our next experiment. Do you have any suggestion on which antibody would work the best for IHC-P?

Verified Customer

Verified customer

Asked: 2020-03-24

Answer

I took a look at the website and datasheets of our anti-AIF/AIFM1 antibody and it seems that PB9366 has been validated on human in both WB and IHC-P. Thus PB9366 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC-P in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC-P detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2020-03-24

Question

I was wanting to use your anti-AIF/AIFM1 antibody for IHC-P for mouse cervix carcinoma on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse cervix carcinoma identification?

Verified Customer

Verified customer

Asked: 2020-01-16

Answer

As indicated on the product datasheet, PB9366 anti-AIF/AIFM1 antibody has been validated for Flow Cytometry, IHC-P, IHC-F, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse cervix carcinoma in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-01-16

Question

We have been able to see staining in rat kidney. Any tips? Is anti-AIF/AIFM1 antibody supposed to stain kidney positively?

Verified Customer

Verified customer

Asked: 2019-11-27

Answer

From what I have seen in literature kidney does express AIFM1. From what I have seen in Uniprot.org, AIFM1 is expressed in apex of heart, kidney, brain, cervix carcinoma, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have AIFM1 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 10913597, 15489334
Cervix carcinoma, Pubmed ID: 18669648, 18691976
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Kidney, Pubmed ID: 14702039
Liver, Pubmed ID: 24275569

Boster Scientific Support

Answered: 2019-11-27

Question

Our lab want to know about using your anti-AIF/AIFM1 antibody for mitochondrial respiratory chain complex i assembly studies. Has this antibody been tested with western blotting on testis tissue? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2019-10-25

Answer

Thank you for your inquiry. This PB9366 anti-AIF/AIFM1 antibody is validated on human placenta tissue, a549 whole cell lysates, k562 whole cell lysates, hela whole cell lysates, mouse ovary tissue, cardiac muscle tissue, rat ovary tissue, intestinal cancer tissue, spleen tissue, lung tissue, liver tissue, testis tissue. It is guaranteed to work for Flow Cytometry, IHC-P, IHC-F, ICC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2019-10-25

Question

Can you help my question with product PB9366, anti-AIF/AIFM1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

C. Moore

Verified customer

Asked: 2019-10-04

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9366 anti-AIF/AIFM1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-10-04

Question

Will PB9366 anti-AIF/AIFM1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-06-11

Answer

It shows on the product datasheet, PB9366 anti-AIF/AIFM1 antibody as been tested on IHC-P. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-06-11

Question

Will anti-AIF/AIFM1 antibody PB9366 work for IHC-P with cervix carcinoma?

J. Rodriguez

Verified customer

Asked: 2019-04-22

Answer

According to the expression profile of cervix carcinoma, AIFM1 is highly expressed in cervix carcinoma. So, it is likely that anti-AIF/AIFM1 antibody PB9366 will work for IHC-P with cervix carcinoma.

Boster Scientific Support

Answered: 2019-04-22

Question

I see that the anti-AIF/AIFM1 antibody PB9366 works with IHC-P, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2018-09-28

Answer

You can find protocols for IHC-P on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2018-09-28

Question

you antibody to test anti-AIF/AIFM1 antibody PB9366 on mouse cervix carcinoma for research purposes, then I may be interested in using anti-AIF/AIFM1 antibody PB9366 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

B. Gonzalez

Verified customer

Asked: 2015-08-21

Answer

The products we sell, including anti-AIF/AIFM1 antibody PB9366, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2015-08-21

Question

Our lab were well pleased with the WB result of your anti-AIF/AIFM1 antibody. However we have been able to see positive staining in liver isoform 5: cytoplasm using this antibody. Is that expected? Could you tell me where is AIFM1 supposed to be expressed?

R. Mangal

Verified customer

Asked: 2014-07-09

Answer

From literature, liver does express AIFM1. Generally AIFM1 expresses in mitochondrion intermembrane space., isoform 3: mitochondrion intermembrane space, isoform 5: cytoplasm. Regarding which tissues have AIFM1 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 10913597, 15489334
Cervix carcinoma, Pubmed ID: 18669648, 18691976
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Kidney, Pubmed ID: 14702039
Liver, Pubmed ID: 24275569

Boster Scientific Support

Answered: 2014-07-09

Question

We are currently using anti-AIF/AIFM1 antibody PB9366 for mouse tissue, and we are happy with the ICC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on horse tissues as well?

C. Krishna

Verified customer

Asked: 2014-04-01

Answer

The anti-AIF/AIFM1 antibody (PB9366) has not been validated for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2014-04-01

Question

Is there a BSA free version of anti-AIF/AIFM1 antibody PB9366 available?

D. Anderson

Verified customer

Asked: 2014-02-06

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-AIF/AIFM1 antibody PB9366 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2014-02-06

Question

Is a blocking peptide available for product anti-AIF/AIFM1 antibody (PB9366)?

S. Huang

Verified customer

Asked: 2013-04-10

Answer

We do provide the blocking peptide for product anti-AIF/AIFM1 antibody (PB9366). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2013-04-10

Order DetailsPrice
PB9366

100μg

$370
PB9366-10ug

10μg sample (liquid)

$99
PB9366-Biotin

100 μg Biotin conjugated

$570
PB9366-Cy3

100 μg Cy3 conjugated

$570
PB9366-Dylight488

100 μg Dylight488 conjugated

$570
PB9366-Dylight550

100 μg Dylight550 conjugated

$570
PB9366-Dylight594

100 μg Dylight594 conjugated

$570
PB9366-FITC

100 μg FITC conjugated

$570
PB9366-HRP

100 μg HRP conjugated

$570
PB9366-APC

100 μg APC conjugated

$670
PB9366-PE

100 μg PE conjugated

$670
PB9366-iFluor647

100 μg iFluor647 conjugated

$670
PB9366-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9366
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.