Anti-Bax Antibody Picoband®

BAX antibody

Boster Bio Anti-Bax Antibody Picoband® catalog # A00183. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 240 publication(s).

Product Info Summary

SKU: A00183
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC, WB

Product Name

Anti-Bax Antibody Picoband®

View all BAX Antibodies

SKU/Catalog Number

A00183

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Bax Antibody Picoband® catalog # A00183. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Bax Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00183)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human Bax, different from the related mouse and rat sequences by five amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

A00183 is reactive to BAX in Human, Mouse, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

21 kDa

Calculated molecular weight

21184 MW

Background of BAX

Apoptosis regulator BAX, also known as bcl-2-like protein 4, is a protein that in humans is encoded by the BAX gene. The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. Additionally, this protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A00183 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human

Positive Control

WB: rat thymus tissue, mouse thymus tissue, HEPA1-6 whole cell, HELA whole cell, MCF-7 whole cell
IHC: human lung cancer tissue, rat intestine tissue, human intetsinal cancer tissue, mouse intestine tissue
FCM: A549 cell

Validation Images & Assay Conditions

Gene/Protein Information For BAX (Source: Uniprot.org, NCBI)

Gene Name

BAX

Full Name

Apoptosis regulator BAX

Weight

21184 MW

Superfamily

Bcl-2 family

Alternative Names

Apoptosis regulator BAX;Bcl-2-like protein 4;Bcl2-L-4;BAX;BCL2L4; BAX BCL2L4 BCL2 associated X, apoptosis regulator apoptosis regulator BAX|BCL2 associated X protein|BCL2-associated X protein omega|Baxdelta2G9|Baxdelta2G9omega|Baxdelta2omega|bcl-2-like protein 4|bcl2-L-4

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on BAX, check out the BAX Infographic

BAX infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BAX: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

A00183 has been cited in 240 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Inhibition of glioblastoma growth and invasion by 125I brachytherapy in rat glioma model

Lipoxin A4 pretreatment mitigates skeletal muscle ischemia-reperfusion injury in rats

Fenofibrate, a PPARα agonist, protect proximal tubular cells from albumin-bound fatty acids induced apoptosis via the activation of NF-kB

Effect of curcumin on Bcl-2 and Bax expression in nude mice prostate cancer

Alpha-lipoic acid attenuates trinitrobenzene sulfonic acid-induced ulcerative colitis in mice

Methacryloxylethyl Cetyl Ammonium Chloride Induces DNA Damage and Apoptosis in Human Dental Pulp Cells via Generation of Oxidative Stress

RNA interference-mediated knockdown of brain-derived neurotrophic factor (BDNF) promotes cell cycle arrest and apoptosis in B-cell lymphoma cells.

Knockdown of SERPINE1 reverses resistance of triple‑negative breast cancer to paclitaxel via suppression of VEGFA

Maspin suppresses growth, proliferation and invasion in cutaneous squamous cell carcinoma cells

Calcium release induced by 2-pyridinecarboxaldehyde thiosemicarbazone and its copper complex contributes to tumor cell death

Have you used Anti-Bax Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Bax Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-Bax Antibody Picoband®

Question

Can you help my question with product A00183, anti-Bax antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2020-03-11

Answer

We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00183 anti-Bax antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-03-11

Question

Our team were happy with the WB result of your anti-Bax antibody. However we have observed positive staining in ovarian carcinoma isoform delta: cytoplasm. using this antibody. Is that expected? Could you tell me where is BAX supposed to be expressed?

Verified Customer

Verified customer

Asked: 2020-02-28

Answer

From literature, ovarian carcinoma does express BAX. Generally BAX expresses in isoform alpha: mitochondrion outer membrane, isoform beta: cytoplasm., isoform gamma: cytoplasm., isoform delta: cytoplasm. Regarding which tissues have BAX expression, here are a few articles citing expression in various tissues:
B-cell, Pubmed ID: 8358790
Brain, Pubmed ID: 9920818
Ovarian carcinoma, Pubmed ID: 14702039
Skin, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2020-02-28

Question

Does anti-Bax antibody A00183 work for WB with b-cell?

Verified Customer

Verified customer

Asked: 2020-02-12

Answer

According to the expression profile of b-cell, BAX is highly expressed in b-cell. So, it is likely that anti-Bax antibody A00183 will work for WB with b-cell.

Boster Scientific Support

Answered: 2020-02-12

Question

We ordered your anti-Bax antibody for ICC on b-cell in the past. I am using mouse, and We are going to use the antibody for WB next. you antibody examining b-cell as well as brain in our next experiment. Could give a recommendation on which antibody would work the best for WB?

Verified Customer

Verified customer

Asked: 2020-01-30

Answer

I have checked the website and datasheets of our anti-Bax antibody and it appears that A00183 has been tested on mouse in both ICC and WB. Thus A00183 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2020-01-30

Question

I was wanting to use your anti-Bax antibody for WB for mouse b-cell on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse b-cell identification?

Verified Customer

Verified customer

Asked: 2019-12-16

Answer

You can see on the product datasheet, A00183 anti-Bax antibody has been tested for Flow Cytometry, IHC, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse b-cell in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-12-16

Question

Is there a BSA free version of anti-Bax antibody A00183 available?

Verified Customer

Verified customer

Asked: 2019-08-08

Answer

Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-Bax antibody A00183 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-08-08

Question

I have attached the WB image, lot number and protocol we used for b-cell using anti-Bax antibody A00183. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-07-04

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-07-04

Question

Does A00183 anti-Bax antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-06-24

Answer

As indicated on the product datasheet, A00183 anti-Bax antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-06-24

Question

Is this A00183 anti-Bax antibody reactive to the isotypes of BAX?

Verified Customer

Verified customer

Asked: 2019-06-11

Answer

The immunogen of A00183 anti-Bax antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17-48aa EQIMKTGALLLQGFIQDRAGRMGGEAPELALD), different from the related mouse and rat sequences by five amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-06-11

Question

We are currently using anti-Bax antibody A00183 for human tissue, and we are satisfied with the ICC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on horse tissues as well?

D. Krishna

Verified customer

Asked: 2018-12-31

Answer

The anti-Bax antibody (A00183) has not been tested for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-12-31

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for b-cell using anti-Bax antibody A00183. Let me know if you need anything else.

L. Banerjee

Verified customer

Asked: 2017-01-09

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2017-01-09

Question

My lab would like to test anti-Bax antibody A00183 on mouse b-cell for research purposes, then I may be interested in using anti-Bax antibody A00183 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

N. Parker

Verified customer

Asked: 2016-12-08

Answer

The products we sell, including anti-Bax antibody A00183, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2016-12-08

Question

We have seen staining in rat skin. Any tips? Is anti-Bax antibody supposed to stain skin positively?

D. Brown

Verified customer

Asked: 2016-04-21

Answer

From literature skin does express BAX. From Uniprot.org, BAX is expressed in mucosa of transverse colon, b-cell, brain, ovarian carcinoma, skin, among other tissues. Regarding which tissues have BAX expression, here are a few articles citing expression in various tissues:
B-cell, Pubmed ID: 8358790
Brain, Pubmed ID: 9920818
Ovarian carcinoma, Pubmed ID: 14702039
Skin, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2016-04-21

Question

We are interested in using your anti-Bax antibody for hypothalamus development studies. Has this antibody been tested with western blotting on a549 cells? We would like to see some validation images before ordering.

Z. Mitchell

Verified customer

Asked: 2015-12-11

Answer

I appreciate your inquiry. This A00183 anti-Bax antibody is validated on rat thymus tissue, mouse thymus tissue, hela whole cell lysates, a549 cells. It is guaranteed to work for Flow Cytometry, IHC, ICC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2015-12-11

Question

Is a blocking peptide available for product anti-Bax antibody (A00183)?

G. Carter

Verified customer

Asked: 2014-09-10

Answer

We do provide the blocking peptide for product anti-Bax antibody (A00183). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2014-09-10

Question

I see that the anti-Bax antibody A00183 works with WB, what is the protocol used to produce the result images on the product page?

C. Baker

Verified customer

Asked: 2013-12-11

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2013-12-11

Order DetailsPrice
A00183

100μg

$370
A00183-10ug

10μg sample (liquid)

$99
A00183-Biotin

100 μg Biotin conjugated

$570
A00183-Cy3

100 μg Cy3 conjugated

$570
A00183-Dylight488

100 μg Dylight488 conjugated

$570
A00183-Dylight550

100 μg Dylight550 conjugated

$570
A00183-Dylight594

100 μg Dylight594 conjugated

$570
A00183-FITC

100 μg FITC conjugated

$570
A00183-HRP

100 μg HRP conjugated

$570
A00183-APC

100 μg APC conjugated

$670
A00183-PE

100 μg PE conjugated

$670
A00183-iFluor647

100 μg iFluor647 conjugated

$670
A00183-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A00183
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.