UXT (NM_004182) Human Recombinant Protein

UXT protein,

Product Info Summary

SKU: PROTQ9UBK9
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

UXT (NM_004182) Human Recombinant Protein

View all UXT recombinant proteins

SKU/Catalog Number

PROTQ9UBK9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ubiquitously-expressed transcript (UXT), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

UXT (NM_004182) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UBK9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18.1 kDa

Amino Acid Sequence

MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH

Validation Images & Assay Conditions

Gene/Protein Information For UXT (Source: Uniprot.org, NCBI)

Gene Name

UXT

Full Name

Protein UXT

Weight

18.1 kDa

Superfamily

UXT family

Alternative Names

Androgen receptor trapped clone 27 protein; ART-27protein UXT; SKP2-associated alpha PFD 1; STAP1; Ubiquitously expressed transcript protein; ubiquitously-expressed transcript UXT ART-27, STAP1 ubiquitously expressed prefoldin like chaperone protein UXT|SKP2-associated alpha PFD 1|androgen receptor trapped clone 27 protein|ubiquitously expressed transcript protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on UXT, check out the UXT Infographic

UXT infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UXT: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UBK9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used UXT (NM_004182) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For UXT (NM_004182) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for UXT (NM_004182) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UBK9
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.