Recombinant Human FGF2 Protein

FGF basic/FGF2/bFGF protein, Human

Fibroblast Growth Factor basic (FGF-basic/FGF-2) is a single-chain polypeptide growth factor that plays a significant role in the process of wound healing and is a potent inducer of angiogenesis. Several different forms of the human protein exist ranging from 18-24 kDa in size due to the use of alternative start sites within the fgf-2 gene. It has a 55 percent amino acid residue identity to FGF-1 and has potent heparin-binding activity. The growth factor is an extremely potent inducer of DNA synthesis in a variety of cell types from mesoderm and neuroectoderm lineages. It was originally named basic fibroblast growth factor based upon its chemical properties and to distinguish it from acidic fibroblast growth factor. Other homologous FGF belonging to the same family are int-2 (FGF-3), FGF-5, FGF-6, K-FGF and KGF ( keratinocyte growth factor = FGF-7). All factors are products of different genes, some of which are Oncogene products ( FGF-3, FGF-4, FGF-5 ).

Product Info Summary

SKU: R00121
Size: 100μg/vial
Origin Species: Human
Source: E. Coli-derived P143-S288

Product Name

Recombinant Human FGF2 Protein

View all FGF basic/FGF2/bFGF recombinant proteins

SKU/Catalog Number

R00121

Size

100μg/vial

Description

Fibroblast Growth Factor basic (FGF-basic/FGF-2) is a single-chain polypeptide growth factor that plays a significant role in the process of wound healing and is a potent inducer of angiogenesis. Several different forms of the human protein exist ranging from 18-24 kDa in size due to the use of alternative start sites within the fgf-2 gene. It has a 55 percent amino acid residue identity to FGF-1 and has potent heparin-binding activity. The growth factor is an extremely potent inducer of DNA synthesis in a variety of cell types from mesoderm and neuroectoderm lineages. It was originally named basic fibroblast growth factor based upon its chemical properties and to distinguish it from acidic fibroblast growth factor. Other homologous FGF belonging to the same family are int-2 (FGF-3), FGF-5, FGF-6, K-FGF and KGF ( keratinocyte growth factor = FGF-7). All factors are products of different genes, some of which are Oncogene products ( FGF-3, FGF-4, FGF-5 ).

Storage & Handling

Lyophilized recombinant mouse Fibroblast Growth Factor basic (FGF-basic/FGF-2) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhFGF2 remains stable up to 2 weeks at 4°C or up to 3 months at -20°C.

Cite This Product

Recombinant Human FGF2 Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # R00121)

Form

Lyophilized

Formulation

Lyophilized after extensive dialysis against PBS.

Purity

>95%, by SDS-PAGE quantitative densitometry by Coomassie® Blue Staining.

Predicted MW

16.5KD

Endotoxin

Less than 1 EU/μg of rHubFGF as determined by LAL method.

Amino Acid Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Validation Images & Assay Conditions

Gene/Protein Information For FGF2 (Source: Uniprot.org, NCBI)

Gene Name

FGF2

Full Name

Fibroblast growth factor 2

Weight

16.5KD

Superfamily

heparin-binding growth factors family

Alternative Names

basic fibroblast growth factor bFGF; Basic fibroblast growth factor; bFGF; FGF basic; FGF2; FGF-2; FGFBprostatropin; fibroblast growth factor 2 (basic); HBGF-2; heparin-binding growth factor 2; Prostatropin FGF2 BFGF, FGF-2, FGFB, HBGF-2 fibroblast growth factor 2 fibroblast growth factor 2|basic fibroblast growth factor bFGF|fibroblast growth factor 2 (basic)|heparin-binding growth factor 2|prostatropin

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FGF2, check out the FGF2 Infographic

FGF2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FGF2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for R00121

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Recombinant Human FGF2 Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Recombinant Human FGF2 Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Recombinant Human FGF2 Protein

$240
In stock, 1 left.

Order within 54 hours and 39 minutes to receive by Tue Nov 19

Get A Quote
In stock
Order Product
R00121
$240.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.