Product Info Summary
SKU: | R00121 |
---|---|
Size: | 100μg/vial |
Origin Species: | Human |
Source: | E. Coli-derived P143-S288 |
Customers Who Bought This Also Bought
Product info
Product Name
Recombinant Human FGF2 Protein
View all FGF basic/FGF2/bFGF recombinant proteins
SKU/Catalog Number
R00121
Size
100μg/vial
Description
Fibroblast Growth Factor basic (FGF-basic/FGF-2) is a single-chain polypeptide growth factor that plays a significant role in the process of wound healing and is a potent inducer of angiogenesis. Several different forms of the human protein exist ranging from 18-24 kDa in size due to the use of alternative start sites within the fgf-2 gene. It has a 55 percent amino acid residue identity to FGF-1 and has potent heparin-binding activity. The growth factor is an extremely potent inducer of DNA synthesis in a variety of cell types from mesoderm and neuroectoderm lineages. It was originally named basic fibroblast growth factor based upon its chemical properties and to distinguish it from acidic fibroblast growth factor. Other homologous FGF belonging to the same family are int-2 (FGF-3), FGF-5, FGF-6, K-FGF and KGF ( keratinocyte growth factor = FGF-7). All factors are products of different genes, some of which are Oncogene products ( FGF-3, FGF-4, FGF-5 ).
Storage & Handling
Lyophilized recombinant mouse Fibroblast Growth Factor basic (FGF-basic/FGF-2) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhFGF2 remains stable up to 2 weeks at 4°C or up to 3 months at -20°C.
Cite This Product
Recombinant Human FGF2 Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # R00121)
Form
Lyophilized
Formulation
Lyophilized after extensive dialysis against PBS.
Purity
>95%, by SDS-PAGE quantitative densitometry by Coomassie® Blue Staining.
Predicted MW
16.5KD
Endotoxin
Less than 1 EU/μg of rHubFGF as determined by LAL method.
Amino Acid Sequence
PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
Boster Kit Box
Protein Target Info & Infographic
Gene/Protein Information For FGF2 (Source: Uniprot.org, NCBI)
Gene Name
FGF2
Full Name
Fibroblast growth factor 2
Weight
16.5KD
Superfamily
heparin-binding growth factors family
Alternative Names
basic fibroblast growth factor bFGF; Basic fibroblast growth factor; bFGF; FGF basic; FGF2; FGF-2; FGFBprostatropin; fibroblast growth factor 2 (basic); HBGF-2; heparin-binding growth factor 2; Prostatropin FGF2 BFGF, FGF-2, FGFB, HBGF-2 fibroblast growth factor 2 fibroblast growth factor 2|basic fibroblast growth factor bFGF|fibroblast growth factor 2 (basic)|heparin-binding growth factor 2|prostatropin
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on FGF2, check out the FGF2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for FGF2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Recombinant Human FGF2 Protein (R00121)
Hello CJ!
No publications found for R00121
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Recombinant Human FGF2 Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Recombinant Human FGF2 Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question