Product Info Summary
SKU: | A03770 |
---|---|
Size: | 100μl |
Reactive Species: | Human, Mouse |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Tra-2 alpha Antibody
SKU/Catalog Number
A03770
Size
100μl
Form
Liquid
Description
Boster Bio Anti-Tra-2 alpha Antibody catalog # A03770. Tested in WB applications. This antibody reacts with Human, Mouse.
Storage & Handling
Store at -20°C for one year. For short term storage and frequent use, store at 4°C for up to one month. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Tra-2 alpha Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03770)
Host
Rabbit
Contents
Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.
Clonality
Polyclonal
Isotype
IgG
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPL Synthetic peptide AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross reactivity with other proteins.
Reactive Species
A03770 is reactive to TRA2A in Human, Mouse
Applications
A03770 is guaranteed for WB Boster Guarantee
Observed Molecular Weight
39 kDa
Calculated molecular weight
32689 MW
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
WB, 1:500-1:2000
Validation Images & Assay Conditions
Click image to see more details
Western Blot (WB) analysis of specific cells using Tra-2alpha Polyclonal antibody.
Protein Target Info & Infographic
Gene/Protein Information For TRA2A (Source: Uniprot.org, NCBI)
Gene Name
TRA2A
Full Name
Transformer-2 protein homolog alpha
Weight
32689 MW
Superfamily
splicing factor SR family
Alternative Names
HSU53209; htra-2 alpha; htra-2-alpha; putative MAPK activating protein PM24; TRA-2 alpha; tra2a; Tra2alpha; TRA2-alpha; transformer 2 alpha homolog (Drosophila); transformer-2 alpha; Transformer-2 protein homolog A; transformer-2 protein homolog alpha TRA2A AWMS1, HSU53209 transformer 2 alpha homolog transformer-2 protein homolog alpha|TRA-2 alpha|TRA2-alpha|Tra2alpha|htra-2 alpha|putative MAPK activating protein PM24|transformer-2 alpha|transformer-2 protein homolog A
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on TRA2A, check out the TRA2A Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for TRA2A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Tra-2 alpha Antibody (A03770)
Hello CJ!
No publications found for A03770
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Tra-2 alpha Antibody?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Tra-2 alpha Antibody
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
3 Customer Q&As for Anti-Tra-2 alpha Antibody
Question
Do you have a BSA free version of anti-Tra-2 alpha antibody A03770 available?
G. Krishna
Verified customer
Asked: 2019-04-17
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Tra-2 alpha antibody A03770 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-04-17
Question
Does anti-Tra-2 alpha antibody A03770 work for WB with prostate?
Verified Customer
Verified customer
Asked: 2017-09-19
Answer
According to the expression profile of prostate, TRA2A is highly expressed in prostate. So, it is likely that anti-Tra-2 alpha antibody A03770 will work for WB with prostate.
Boster Scientific Support
Answered: 2017-09-19
Question
We need to test anti-Tra-2 alpha antibody A03770 on human prostate for research purposes, then I may be interested in using anti-Tra-2 alpha antibody A03770 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
F. Edwards
Verified customer
Asked: 2015-08-07
Answer
The products we sell, including anti-Tra-2 alpha antibody A03770, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2015-08-07