Anti-Tra-2 alpha Antibody

Product Name

Anti-Tra-2 alpha Antibody

View all TRA2A Antibodies

SKU/Catalog Number

A03770

Size

100μl

Form

Liquid

Description

Boster Bio Anti-Tra-2 alpha Antibody catalog # A03770. Tested in WB applications. This antibody reacts with Human, Mouse.

Storage & Handling

Store at -20°C for one year. For short term storage and frequent use, store at 4°C for up to one month. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Tra-2 alpha Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03770)

Host

Rabbit

Contents

Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.

Clonality

Polyclonal

Isotype

IgG

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPL Synthetic peptide AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross reactivity with other proteins.

Reactive Species

A03770 is reactive to TRA2A in Human, Mouse

Applications

A03770 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

39 kDa

Calculated molecular weight

32689 MW

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

WB, 1:500-1:2000

Validation Images & Assay Conditions

Click image to see more details

Western Blot (WB) analysis of specific cells using Tra-2alpha Polyclonal antibody.

Gene/Protein Information For TRA2A (Source: Uniprot.org, NCBI)

Alternative Names

HSU53209; htra-2 alpha; htra-2-alpha; putative MAPK activating protein PM24; TRA-2 alpha; tra2a; Tra2alpha; TRA2-alpha; transformer 2 alpha homolog (Drosophila); transformer-2 alpha; Transformer-2 protein homolog A; transformer-2 protein homolog alpha TRA2A AWMS1, HSU53209 transformer 2 alpha homolog transformer-2 protein homolog alpha|TRA-2 alpha|TRA2-alpha|Tra2alpha|htra-2 alpha|putative MAPK activating protein PM24|transformer-2 alpha|transformer-2 protein homolog A

For more info on TRA2A, check out the TRA2A Infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TRA2A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Take me to the TRA2A Infographic

Here are featured tools and databases that you might find useful.

• Boster's Pathways Library
• Protein Databases
• Bioscience Research Protocol Resources
• Data Processing & Analysis Software
• Photo Editing Software
• Scientific Literature Resources
• Research Paper Management Tools
• Molecular Biology Software
• Primer Design Tools
• Bioinformatics Tools
• Phylogenetic Tree Analysis