RAP1B (NM_001010942) Human Recombinant Protein

RAP1B protein,

Product Info Summary

SKU: PROTP61224
Size: 20 µg
Source: HEK293T

Product Name

RAP1B (NM_001010942) Human Recombinant Protein

View all RAP1B recombinant proteins

SKU/Catalog Number

PROTP61224

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RAP1B (NM_001010942) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP61224)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.6 kDa

Amino Acid Sequence

MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL

Validation Images & Assay Conditions

Gene/Protein Information For RAP1B (Source: Uniprot.org, NCBI)

Gene Name

RAP1B

Full Name

Ras-related protein Rap-1b

Weight

20.6 kDa

Superfamily

small GTPase superfamily

Alternative Names

DKFZp586H0723; GTP-binding protein smg p21B; KREV; K-REV; RAL1B; Rap1B; RAP1B, member of RAS oncogene family; Ras family small GTP binding protein RAP1B; RAS-related protein RAP1B; ras-related protein Rap-1b; small GTP binding protein RAP1B K-REV, RAL1B RAP1B, member of RAS oncogene family ras-related protein Rap-1b|GTP-binding protein smg p21B|RAS-related protein RAP1B|Ras family small GTP binding protein RAP1B|small GTP binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RAP1B, check out the RAP1B Infographic

RAP1B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RAP1B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP61224

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RAP1B (NM_001010942) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RAP1B (NM_001010942) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RAP1B (NM_001010942) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP61224
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.