PPP1R14D (NM_017726) Human Recombinant Protein

PPP1R14D/GBPI-1 protein,

Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 14D (PPP1R14D), transcript variant 1

Product Info Summary

SKU: PROTQ9NXH3
Size: 20 µg
Source: HEK293T

Product Name

PPP1R14D (NM_017726) Human Recombinant Protein

View all PPP1R14D/GBPI-1 recombinant proteins

SKU/Catalog Number

PROTQ9NXH3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 14D (PPP1R14D), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PPP1R14D (NM_017726) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NXH3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.3 kDa

Amino Acid Sequence

MLSSSPASCTSPSPDGENPCKKVHWASGRRRTSSTDSESKSHPDSSKIPRSRRPSRLTVKYDRGQLQRWLEMEQWVDAQVQELFQDQATPSEPEIDLEALMDLSTEEQKTQLEAILGNCPRPTEAFISELLSQLKKLRRLSRPQK

Validation Images & Assay Conditions

Gene/Protein Information For PPP1R14D (Source: Uniprot.org, NCBI)

Gene Name

PPP1R14D

Full Name

Protein phosphatase 1 regulatory subunit 14D

Weight

16.3 kDa

Superfamily

PP1 inhibitor family

Alternative Names

CPI17-like; FLJ20251; gastrointestinal and brain-specific PP1-inhibitory protein 1; GBPI; GBPI1; GBPI-1; gut and brain phosphatase inhibitor 1; MGC119014; MGC119016; PKC-dependent PP1 inhibitory protein; protein phosphatase 1 regulatory subunit 14D; protein phosphatase 1, regulatory (inhibitor) subunit 14D PPP1R14D CPI17-like, GBPI-1, GBPI1 protein phosphatase 1 regulatory inhibitor subunit 14D protein phosphatase 1 regulatory subunit 14D|PKC-dependent PP1 inhibitory protein|gastrointestinal and brain-specific PP1-inhibitory protein 1|gut and brain phosphatase inhibitor 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PPP1R14D, check out the PPP1R14D Infographic

PPP1R14D infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PPP1R14D: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NXH3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PPP1R14D (NM_017726) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PPP1R14D (NM_017726) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PPP1R14D (NM_017726) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NXH3
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.