POLR3D (NM_001722) Human Recombinant Protein

POLR3D protein,

Recombinant protein of human polymerase (RNA) III (DNA directed) polypeptide D, 44kDa (POLR3D)

Product Info Summary

SKU: PROTP05423
Size: 20 µg
Source: HEK293T

Product Name

POLR3D (NM_001722) Human Recombinant Protein

View all POLR3D recombinant proteins

SKU/Catalog Number

PROTP05423

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human polymerase (RNA) III (DNA directed) polypeptide D, 44kDa (POLR3D)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

POLR3D (NM_001722) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP05423)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

44.2 kDa

Amino Acid Sequence

MSEGNAAGEPSTPGGPRPLLTGARGLIGRRPAPPLTPGRLPSIRSRDLTLGGVKKKTFTPNIISRKIKEEPKEEVTVKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDVSDMGPSHIINIKKEKRETDEETKQILRMLEKDDFLDDPGLRNDTRNMPVQLPLAHSGWLFKEENDEPDVKPWLAGPKEEDMEVDIPAVKVKEEPRDEEEEAKMKAPPKAARKTPGLPKDVSVAELLRELSLTKEEELLFLQLPDTLPGQPPTQDIKPIKTEVQGEDGQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDHKHR

Validation Images & Assay Conditions

Gene/Protein Information For POLR3D (Source: Uniprot.org, NCBI)

Gene Name

POLR3D

Full Name

DNA-directed RNA polymerase III subunit RPC4

Weight

44.2 kDa

Superfamily

eukaryotic RPC4/POLR3D RNA polymerase subunit family

Alternative Names

BN51 (BHK21) temperature sensitivity complementing; BN51; BN51TDNA-directed RNA polymerase III 47 kDa polypeptide; DNA-directed RNA polymerase III subunit D; DNA-directed RNA polymerase III subunit RPC4; polymerase (RNA) III (DNA directed) polypeptide D, 44kDa; Protein BN51; RNA polymerase III 47 kDa subunit; RNA polymerase III subunit C4; RPC4; RPC53 homolog; temperature sensitive complementation, cell cycle specific, tsBN51; TSBN51RPC53 POLR3D BN51T, C53, RPC4, RPC53, TSBN51 RNA polymerase III subunit D DNA-directed RNA polymerase III subunit RPC4|BN51 (BHK21) temperature sensitivity complementing|DNA-directed RNA polymerase III 47 kDa polypeptide|DNA-directed RNA polymerase III subunit D|RNA polymerase III 47 kDa subunit|RNA polymerase III subunit C4|RPC53 homolog|polymerase (RNA) III (DNA directed) polypeptide D, 44kDa|polymerase (RNA) III subunit D|temperature sensitive complementation, cell cycle specific, tsBN51

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on POLR3D, check out the POLR3D Infographic

POLR3D infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for POLR3D: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP05423

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used POLR3D (NM_001722) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For POLR3D (NM_001722) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for POLR3D (NM_001722) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP05423
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.