PKC beta 1 (PRKCB) (NM_212535) Human Recombinant Protein

PRKCB protein,

Recombinant protein of human protein kinase C, beta (PRKCB), transcript variant 1

Product Info Summary

SKU: PROTP05771
Size: 20 µg
Source: HEK293T

Product Name

PKC beta 1 (PRKCB) (NM_212535) Human Recombinant Protein

View all PRKCB recombinant proteins

SKU/Catalog Number

PROTP05771

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human protein kinase C, beta (PRKCB), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PKC beta 1 (PRKCB) (NM_212535) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP05771)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

76.7 kDa

Amino Acid Sequence

MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV

Validation Images & Assay Conditions

Gene/Protein Information For PRKCB (Source: Uniprot.org, NCBI)

Gene Name

PRKCB

Full Name

Protein kinase C beta type

Weight

76.7 kDa

Superfamily

protein kinase superfamily

Alternative Names

EC 2.7.11; EC 2.7.11.13; MGC41878; PKC-B; PKC-beta; PKCBPRKCB2; PRKCB1protein kinase C beta 1; protein kinase C beta type; protein kinase C, beta 1 polypeptide; protein kinase C, beta 1; protein kinase C, beta PRKCB PKC-beta, PKCB, PKCI(2), PKCbeta1, PRKCB2, PRKCB protein kinase C beta protein kinase C beta type|PKC-B|protein kinase C, beta 1 polypeptide

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PRKCB, check out the PRKCB Infographic

PRKCB infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PRKCB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP05771

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PKC beta 1 (PRKCB) (NM_212535) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PKC beta 1 (PRKCB) (NM_212535) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PKC beta 1 (PRKCB) (NM_212535) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP05771
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.