MD2 (LY96) (NM_001195797) Human Recombinant Protein

MD-2 protein,

Purified recombinant protein of Homo sapiens lymphocyte antigen 96 (LY96), transcript variant 2.

Product Info Summary

SKU: PROTQ9Y6Y9
Size: 20 µg
Source: HEK293T

Product Name

MD2 (LY96) (NM_001195797) Human Recombinant Protein

View all MD-2 recombinant proteins

SKU/Catalog Number

PROTQ9Y6Y9

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens lymphocyte antigen 96 (LY96), transcript variant 2.

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MD2 (LY96) (NM_001195797) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y6Y9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

0.0149kDa

Amino Acid Sequence

MLPFLFFSTLFSSIFTEAQKQYWVCNSSDASISYTYCGRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN

Validation Images & Assay Conditions

Gene/Protein Information For LY96 (Source: Uniprot.org, NCBI)

Gene Name

LY96

Full Name

Lymphocyte antigen 96

Weight

0.0149kDa

Alternative Names

ESOP1; ESOP-1; LY96; ly-96; lymphocyte antigen 96; MD2; MD-2; myeloid differentiation protein-2; Protein MD-2 Ly96|ESO, ESOP-1, MD-2, MD2|lymphocyte 96|lymphocyte 96|ly-96|myeloid differentiation factor-2|myeloid differentiation protein-2|protein MD-2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LY96, check out the LY96 Infographic

LY96 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LY96: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y6Y9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MD2 (LY96) (NM_001195797) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MD2 (LY96) (NM_001195797) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MD2 (LY96) (NM_001195797) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y6Y9
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.