Click image to see more details
Product Info Summary
| SKU: | A00002-2 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Mouse |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-TNF alpha Antibody Picoband®
SKU/Catalog Number
A00002-2
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-TNF alpha Antibody Picoband® catalog # A00002-2. Tested in WB applications. This antibody reacts with Mouse. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-TNF alpha Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00002-2)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of mouse TNF alpha, different from the related human sequence by five amino acids, and from the related rat sequence by three amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00002-2 is reactive to Tnf in Mouse
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
25 kDa
Calculated molecular weight
25896 MW
Background of TNF-alpha
TNFα (Tumor Necrosis Factor alpha) gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. And this cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. Moreover, this cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00002-2 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Mouse
Positive Control
WB: mouse thymus tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of TNF alpha using anti-TNF alpha antibody (A00002-2).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: mouse thymus tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-TNF alpha antigen affinity purified polyclonal antibody (Catalog # A00002-2) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for TNF alpha at approximately 25KD. The expected band size for TNF alpha is at 25KD.
Protein Target Info & Infographic
Gene/Protein Information For Tnf (Source: Uniprot.org, NCBI)
Gene Name
Tnf
Full Name
Tumor necrosis factor
Weight
25896 MW
Superfamily
Tumor necrosis factor family
Alternative Names
Tumor necrosis factor;Cachectin;TNF-alpha;Tumor necrosis factor ligand superfamily member 2;TNF-a;Tumor necrosis factor, membrane form;N-terminal fragment;NTF;Intracellular domain 1;ICD1;Intracellular domain 2;ICD2;C-domain 1;C-domain 2;Tumor necrosis factor, soluble form;Tnf;Tnfa, Tnfsf2; TNF DIF-alpha, TNFA, TNFSF2, TNLG1F, TNF tumor necrosis factor tumor necrosis factor|APC1 protein|TNF, macrophage-derived|TNF, monocyte-derived|TNF-a|tumor necrosis factor ligand 1F|tumor necrosis factor ligand superfamily member 2|tumor necrosis factor-alpha
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on Tnf, check out the Tnf Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for Tnf: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-TNF alpha Antibody Picoband® (A00002-2)
Hello CJ!
A00002-2 has been cited in 40 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
The pivotal role of the NLRC4 inflammasome in neuroinflammation after intracerebral hemorrhage in rats
Liao L,Huang L,Wei X,Yin L,Wei X,Li T.Bioinformatic and biochemical studies of formononetin against liver injure.Life Sci.2021 Feb 16:119229.doi:10.1016/j.lfs.2021.119229.Epub ahead of print.PMID:33607154.
Species: Mouse
A00002-2 usage in article: APP:WB, SAMPLE:LIVER TISSUE, DILUTION:NA
Liao L,Huang L,Wei X,Yin L,Wei X,Li T.Bioinformatic and biochemical studies of formononetin against liver injure.Life Sci.2021 Feb 16:119229.doi:10.1016/j.lfs.2021.119229.Epub ahead of print.PMID:33607154.
Species: Mouse
A00002-2 usage in article: APP:WB, SAMPLE:LIVER TISSUE, DILUTION:NA
Ye D,Hu Y,Zhu N,Gu W,Long G,Tao E,Fang M,Jiang M. Exploratory Investigation of Intestinal Structure and Function after Stroke in Mice. Mediators Inflamm.2021 Feb 15;2021:1315797.doi: 10.1155/2021/1315797.PMID:33642941;PMCID:PMC7902147.
Species: Mouse
A00002-2 usage in article: APP:WB, SAMPLE:INTESTINE TISSUE, DILUTION:1:400
Resveratrol attenuates hyperoxia%u2010induced oxidative stress, inflammation and fibrosis and suppresses Wnt/%u03B2%u2010catenin signalling in lungs of neonatal rats
Efficacy of acetylshikonin in preventing obesity and hepatic steatosis in db/db mice
Protective effects of baicalin on carbon tetrachloride induced liver injury by activating PPAR%u03B3 and inhibiting TGF%u03B21
Immunomodulatory properties of quercetin-3-O-%u03B1-L-rhamnopyranoside from Rapanea melanophloeos against influenza a virus
Neuroprotective effects of %u03B1-lipoic acid on long-term experimental autoimmune encephalomyelitis.
Polymeric micelles for potentiated antiulcer and anticancer activities of naringin
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-TNF alpha Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-TNF alpha Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-TNF alpha Antibody Picoband®
Question
Do you have a BSA free version of anti-TNF alpha antibody A00002-2 available?
Verified Customer
Verified customer
Asked: 2020-04-28
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-TNF alpha antibody A00002-2 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-04-28
Question
Our lab were satisfied with the WB result of your anti-TNF alpha antibody. However we have seen positive staining in leukocyte cell membrane using this antibody. Is that expected? Could you tell me where is TNF supposed to be expressed?
Verified Customer
Verified customer
Asked: 2020-03-09
Answer
Based on literature, leukocyte does express TNF. Generally TNF expresses in cell membrane. Regarding which tissues have TNF expression, here are a few articles citing expression in various tissues:
Blood, Pubmed ID: 15489334
Prostatic carcinoma, Pubmed ID: 8597870, 10205166
Boster Scientific Support
Answered: 2020-03-09
Question
Is a blocking peptide available for product anti-TNF alpha antibody (A00002-2)?
Verified Customer
Verified customer
Asked: 2020-01-23
Answer
We do provide the blocking peptide for product anti-TNF alpha antibody (A00002-2). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2020-01-23
Question
We are interested in using your anti-TNF alpha antibody for extrinsic apoptotic signaling pathway via death domain receptors studies. Has this antibody been tested with western blotting on mouse thymus tissue? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2020-01-08
Answer
We appreciate your inquiry. This A00002-2 anti-TNF alpha antibody is validated on mouse thymus tissue. It is guaranteed to work for WB in mouse. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2020-01-08
Question
I have attached the WB image, lot number and protocol we used for prostatic carcinoma using anti-TNF alpha antibody A00002-2. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-12-25
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-12-25
Question
Will anti-TNF alpha antibody A00002-2 work for WB with prostatic carcinoma?
Verified Customer
Verified customer
Asked: 2019-09-24
Answer
According to the expression profile of prostatic carcinoma, TNF is highly expressed in prostatic carcinoma. So, it is likely that anti-TNF alpha antibody A00002-2 will work for WB with prostatic carcinoma.
Boster Scientific Support
Answered: 2019-09-24
Question
I see that the anti-TNF alpha antibody A00002-2 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-09-17
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-09-17
Question
We have observed staining in mouse prostatic carcinoma. Any tips? Is anti-TNF alpha antibody supposed to stain prostatic carcinoma positively?
Verified Customer
Verified customer
Asked: 2019-08-26
Answer
According to literature prostatic carcinoma does express TNF. According to Uniprot.org, TNF is expressed in leukocyte, blood, prostatic carcinoma, among other tissues. Regarding which tissues have TNF expression, here are a few articles citing expression in various tissues:
Blood, Pubmed ID: 15489334
Prostatic carcinoma, Pubmed ID: 8597870, 10205166
Boster Scientific Support
Answered: 2019-08-26
Question
I was wanting to use your anti-TNF alpha antibody for WB for mouse prostatic carcinoma on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse prostatic carcinoma identification?
Verified Customer
Verified customer
Asked: 2019-01-08
Answer
As indicated on the product datasheet, A00002-2 anti-TNF alpha antibody has been validated for WB on mouse tissues. We have an innovator award program that if you test this antibody and show it works in mouse prostatic carcinoma in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-01-08
Question
Is this A00002-2 anti-TNF alpha antibody reactive to the isotypes of TNF?
J. Walker
Verified customer
Asked: 2018-10-15
Answer
The immunogen of A00002-2 anti-TNF alpha antibody is A synthetic peptide corresponding to a sequence at the C-terminus of mouse TNF alpha (202-235aa FQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL), different from the related human sequence by five amino acids, and from the related rat sequence by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-10-15
Question
I have a question about product A00002-2, anti-TNF alpha antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
D. Kulkarni
Verified customer
Asked: 2017-10-06
Answer
We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00002-2 anti-TNF alpha antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2017-10-06
Question
Will A00002-2 anti-TNF alpha antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
T. Collins
Verified customer
Asked: 2017-09-05
Answer
As indicated on the product datasheet, A00002-2 anti-TNF alpha antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2017-09-05
Question
I am looking for to test anti-TNF alpha antibody A00002-2 on mouse prostatic carcinoma for research purposes, then I may be interested in using anti-TNF alpha antibody A00002-2 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2017-06-21
Answer
The products we sell, including anti-TNF alpha antibody A00002-2, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2017-06-21
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for prostatic carcinoma using anti-TNF alpha antibody A00002-2. Let me know if you need anything else.
S. Carter
Verified customer
Asked: 2017-05-25
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2017-05-25
Question
We are currently using anti-TNF alpha antibody A00002-2 for mouse tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says mouse. Is it true that the antibody can work on pig tissues as well?
B. Kulkarni
Verified customer
Asked: 2015-04-29
Answer
The anti-TNF alpha antibody (A00002-2) has not been validated for cross reactivity specifically with pig tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2015-04-29
