Product Info Summary
SKU: | PROTQ9GZV9-5 |
---|---|
Size: | 5ug,20ug,100ug,500ug,1mg |
Origin Species: | Human |
Source: | Escherichia coli |
Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant FGF-23 (Fibroblast growth factor-23) protein, AF
View all FGF-23 recombinant proteins
SKU/Catalog Number
PROTQ9GZV9-5
Size
5ug,20ug,100ug,500ug,1mg
Tag
His Tag (C-term)
Description
Fibroblast Growth Factors-23 (FGF-23) is a 28 kDa member of the fibroblast Growth Factors with 251 amino acid residues. FGF-23 is expressed from brain, hepatic stellate cells, cone photoreceptor cells, early spermatids. FGF-23 involved phosphate metabolism and vitamin D metabolism. Negatively regulates osteoblast differentiation and matrix mineralization.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant FGF-23 (Fibroblast growth factor-23) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9GZV9-5)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
27.954kDa
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI with polyhistidine tag at the C-terminus.
Assay dilution & Images
Validation Images & Assay Conditions
There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.
Protein Target Info & Infographic
Gene/Protein Information For FGF23 (Source: Uniprot.org, NCBI)
Gene Name
FGF23
Full Name
Fibroblast growth factor 23
Weight
27.954kDa
Superfamily
heparin-binding growth factors family
Alternative Names
ADHR; FGF23; FGF-23; fibroblast growth factor 23; HPDR2; HYPF; phosphatonin; PHPTC; tumor-derived hypophosphatemia inducing factor; Tumor-derived hypophosphatemia-inducing factor FGF23 ADHR, FGFN, HFTC2, HPDR2, HYPF, PHPTC fibroblast growth factor 23 fibroblast growth factor 23|phosphatonin|tumor-derived hypophosphatemia inducing factor
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on FGF23, check out the FGF23 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for FGF23: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant FGF-23 (Fibroblast growth factor-23) protein, AF (PROTQ9GZV9-5)
Hello CJ!
No publications found for PROTQ9GZV9-5
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant FGF-23 (Fibroblast growth factor-23) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant FGF-23 (Fibroblast growth factor-23) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question