HOXB1 (NM_002144) Human Recombinant Protein

HOXB1 protein,

Recombinant protein of human homeobox B1 (HOXB1)

Product Info Summary

SKU: PROTP14653
Size: 20 µg
Source: HEK293T

Product Name

HOXB1 (NM_002144) Human Recombinant Protein

View all HOXB1 recombinant proteins

SKU/Catalog Number

PROTP14653

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human homeobox B1 (HOXB1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HOXB1 (NM_002144) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP14653)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

32 kDa

Amino Acid Sequence

MDYNRMNSFLEYPLCNRGPSAYSAHSAPTSFPPSSAQAVDSYASEGRYGGGLSSPAFQQNSGYPAQQPPSTLGVPFPSSAPSGYAPAACSPSYGPSQYYPLGQSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPGPYPPQHPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPTARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKKREREEGRVPPAPPGCPKEAAGDASDQSTCTSPEASPSSVTS

Validation Images & Assay Conditions

Gene/Protein Information For HOXB1 (Source: Uniprot.org, NCBI)

Gene Name

HOXB1

Full Name

Homeobox protein Hox-B1

Weight

32 kDa

Superfamily

Antp homeobox family

Alternative Names

homeo box 2I; homeo box B1; homeobox B1; Homeobox protein Hox-2I; homeobox protein Hox-B1; HOX2; Hox-2.9; HOX2I; HOX2IMGC116844; HOXB1; MGC116843; MGC116845 HOXB1 HCFP3, HOX2, HOX2I, Hox-2.9 homeobox B1 homeobox protein Hox-B1|homeobox protein Hox-2I

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HOXB1, check out the HOXB1 Infographic

HOXB1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HOXB1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP14653

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HOXB1 (NM_002144) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HOXB1 (NM_002144) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HOXB1 (NM_002144) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP14653
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.