Click image to see more details
Product Info Summary
| SKU: | A04724-1 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-HOXB1 Antibody Picoband®
SKU/Catalog Number
A04724-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-HOXB1 Antibody Picoband® catalog # A04724-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-HOXB1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04724-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human HOXB1, different from the related mouse sequence by four amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A04724-1 is reactive to HOXB1 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
32 kDa
Calculated molecular weight
32193 MW
Background of HOXB1
Homeobox protein Hox-B1 is a protein that in humans is encoded by the HOXB1 gene. This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A04724-1 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Positive Control
WB: rat testis tissue, mouse testis tissue, human MCF-7 whole Cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of HOXB1 using anti-HOXB1 antibody (A04724-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat testis tissue lysate,
Lane 2: mouse testis tissue lysate,
Lane 3: human MCF-7 whole Cell lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-HOXB1 antigen affinity purified polyclonal antibody (Catalog # A04724-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for HOXB1 at approximately 32KD. The expected band size for HOXB1 is at 32KD.
Protein Target Info & Infographic
Gene/Protein Information For HOXB1 (Source: Uniprot.org, NCBI)
Gene Name
HOXB1
Full Name
Homeobox protein Hox-B1
Weight
32193 MW
Superfamily
Antp homeobox family
Alternative Names
Homeobox protein Hox-B1;Homeobox protein Hox-2I;HOXB1;HOX2I; HOXB1 HCFP3, HOX2, HOX2I, Hox-2.9 homeobox B1 homeobox protein Hox-B1|homeobox protein Hox-2I
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on HOXB1, check out the HOXB1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for HOXB1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-HOXB1 Antibody Picoband® (A04724-1)
Hello CJ!
No publications found for A04724-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-HOXB1 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-HOXB1 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
13 Customer Q&As for Anti-HOXB1 Antibody Picoband®
Question
Will A04724-1 anti-HOXB1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-05-04
Answer
As indicated on the product datasheet, A04724-1 anti-HOXB1 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-05-04
Question
Is there a BSA free version of anti-HOXB1 antibody A04724-1 available?
Verified Customer
Verified customer
Asked: 2020-04-30
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-HOXB1 antibody A04724-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-04-30
Question
I was wanting to use your anti-HOXB1 antibody for WB for mouse skeletal muscle tissue on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse skeletal muscle tissue identification?
Verified Customer
Verified customer
Asked: 2019-12-25
Answer
As indicated on the product datasheet, A04724-1 anti-HOXB1 antibody has been validated for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse skeletal muscle tissue in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-12-25
Question
Is this A04724-1 anti-HOXB1 antibody reactive to the isotypes of HOXB1?
Verified Customer
Verified customer
Asked: 2019-12-11
Answer
The immunogen of A04724-1 anti-HOXB1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human HOXB1 (176-220aa TARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEK), different from the related mouse sequence by four amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-12-11
Question
We are currently using anti-HOXB1 antibody A04724-1 for mouse tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on monkey tissues as well?
R. Jha
Verified customer
Asked: 2019-11-11
Answer
The anti-HOXB1 antibody (A04724-1) has not been validated for cross reactivity specifically with monkey tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-11-11
Question
Can you help my question with product A04724-1, anti-HOXB1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-11-07
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A04724-1 anti-HOXB1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-11-07
Question
Is a blocking peptide available for product anti-HOXB1 antibody (A04724-1)?
Verified Customer
Verified customer
Asked: 2019-10-14
Answer
We do provide the blocking peptide for product anti-HOXB1 antibody (A04724-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-10-14
Question
We are interested in to test anti-HOXB1 antibody A04724-1 on mouse skeletal muscle tissue for research purposes, then I may be interested in using anti-HOXB1 antibody A04724-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-07-10
Answer
The products we sell, including anti-HOXB1 antibody A04724-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-07-10
Question
I see that the anti-HOXB1 antibody A04724-1 works with WB, what is the protocol used to produce the result images on the product page?
O. Zhang
Verified customer
Asked: 2019-06-12
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-06-12
Question
Will anti-HOXB1 antibody A04724-1 work on primate WB with skeletal muscle tissue?
Verified Customer
Verified customer
Asked: 2019-04-03
Answer
Our lab technicians have not validated anti-HOXB1 antibody A04724-1 on primate. You can run a BLAST between primate and the immunogen sequence of anti-HOXB1 antibody A04724-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated primate samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in primate skeletal muscle tissue in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-04-03
Question
Please see the WB image, lot number and protocol we used for skeletal muscle tissue using anti-HOXB1 antibody A04724-1. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2018-08-22
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-08-22
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for skeletal muscle tissue using anti-HOXB1 antibody A04724-1. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2018-08-02
Answer
Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-08-02
Question
Will anti-HOXB1 antibody A04724-1 work for WB with skeletal muscle tissue?
A. Wu
Verified customer
Asked: 2017-01-25
Answer
According to the expression profile of skeletal muscle tissue, HOXB1 is highly expressed in skeletal muscle tissue. So, it is likely that anti-HOXB1 antibody A04724-1 will work for WB with skeletal muscle tissue.
Boster Scientific Support
Answered: 2017-01-25
