GLEPP1 (PTPRO) (NM_030669) Human Recombinant Protein

PTPRO protein,

Recombinant protein of human protein tyrosine phosphatase, receptor type, O (PTPRO), transcript variant 3

Product Info Summary

SKU: PROTQ16827
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

GLEPP1 (PTPRO) (NM_030669) Human Recombinant Protein

View all PTPRO recombinant proteins

SKU/Catalog Number

PROTQ16827

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human protein tyrosine phosphatase, receptor type, O (PTPRO), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

GLEPP1 (PTPRO) (NM_030669) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ16827)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

47 kDa

Amino Acid Sequence

MVTEMNPNVVVISVLAILSTLLIGLLLVTLIILRKKHLQMARECGAGTFVNFASLERDGKLPYNWRRSIFAFLTLLPSCLWTDYLLAFYINPWSKNGLKKRKLTNPVQLDDFDAYIKDMAKDSDYKFSLQFEELKLIGLDIPHFAADLPLNRCKNRYTNILPYDFSRVRLVSMNEEEGADYINANYIPGYNSPQEYIATQGPLPETRNDFWKMVLQQKSQIIVMLTQCNEKRRVKCDHYWPFTEEPIAYGDITVEMISEEEQDDWACRHFRINYADEMQDVMHFNYTAWPDHGVPTANAAESILQFVHMVRQQATKSKGPMIIHCSAGVGRTGTFIALDRLLQHIRDHEFVDILGLVSEMRSYRMSMVQTEEQYIFIHQCVQLMWMKKKQQFCISDVIYENVSKS

Validation Images & Assay Conditions

Gene/Protein Information For PTPRO (Source: Uniprot.org, NCBI)

Gene Name

PTPRO

Full Name

Receptor-type tyrosine-protein phosphatase O

Weight

47 kDa

Superfamily

protein-tyrosine phosphatase family

Alternative Names

EC 3.1.3.48; GLEPP1PTPROt; Glomerular epithelial protein 1; phosphotyrosine phosphatase U2; protein tyrosine phosphatase PTP-U2; Protein tyrosine phosphatase U2; protein tyrosine phosphatase, receptor type, O; PTPase U2; PTP-oc; PTP-U2glomerular epithelial protein-1; PTPU2osteoclastic transmembrane protein-tyrosine phosphatase; receptor-type protein tyrosine phosphatase O; receptor-type tyrosine-protein phosphatase O; R-PTP-O PTPRO GLEPP1, NPHS6, PTP-OC, PTP-U2T, PTPU2, R-PTP-O, PTPRO protein tyrosine phosphatase receptor type O receptor-type tyrosine-protein phosphatase O|PTP phi|PTPase U2|glomerular epithelial protein 1|osteoclastic transmembrane protein-tyrosine phosphatase|phosphotyrosine phosphatase U2|protein tyrosine phosphatase PTP-U2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PTPRO, check out the PTPRO Infographic

PTPRO infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PTPRO: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ16827

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GLEPP1 (PTPRO) (NM_030669) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GLEPP1 (PTPRO) (NM_030669) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GLEPP1 (PTPRO) (NM_030669) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ16827
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.