Product Info Summary
SKU: | PB9873 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-MGA Antibody Picoband™
SKU/Catalog Number
PB9873
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-MGA Antibody Picoband™ catalog # PB9873. Tested in WB applications. This antibody reacts with Human.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-MGA Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9873)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human MGA, different from the related mouse sequence by two amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9873 is reactive to MGA in Human
Applications
PB9873 is guaranteed for WB Boster Guarantee
Observed Molecular Weight
334 kDa
Calculated molecular weight
331836 MW
Background of MGA
Mga is a DNA-binding protein that activates the expression of several important virulence genes in Streptococcus pyogenes (group A Streptococcus, GAS) in response to changing environmental conditions. It had been found that the mouse transcription factor Max interacted with Mga. Coimmunoprecipitation analysis confirmed that Max and Mga interacted in transfected HEK293 cells. EMSA revealed that Mga required Max for binding to the E-box sequence CACGTG. The isolated T-box of Mga bound the brachyury T-box-binding site in the absence of Max. Mga repressed transcription of a reporter driven from a T-box-binding site, but coexpression of Mga with Max caused transcriptional activation from the T-box-binding site. Expression of Mga with Max, but not Mga alone, activated transcription from a reporter containing the E-box site.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Validation Images & Assay Conditions
![pb9873 1 WB anti mga picoband antibody pb9873 1 WB anti mga picoband antibody](https://www.bosterbio.com/media/catalog/product/antibody/pb9873-1-WB-anti-mga-picoband-antibody.jpg)
Click image to see more details
Figure 1. Western blot analysis of MGA using anti-MGA antibody (PB9873).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: HELA whole cell lysates,
Lane 2: MCF-7 whole cell lysates,
Lane 3: SW620 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MGA antigen affinity purified polyclonal antibody (Catalog # PB9873) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for MGA at approximately 334 kDa. The expected band size for MGA is at 336 kDa.
Protein Target Info & Infographic
Gene/Protein Information For MGA (Source: Uniprot.org, NCBI)
Gene Name
MGA
Full Name
MAX gene-associated protein
Weight
331836 MW
Alternative Names
FLJ12634; KIAA0518; MAD5; MAX dimerization protein 5; MAX gene associated; MAX gene-associated protein; MXD5 MGA MAD5, MXD5 MAX dimerization protein MGA MAX gene-associated protein|MAX dimerization protein 5|MGA, MAX dimerization protein
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on MGA, check out the MGA Infographic
![MGA infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for MGA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-MGA Antibody Picoband™ (PB9873)
Hello CJ!
No publications found for PB9873
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-MGA Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-MGA Antibody Picoband™
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-MGA Antibody Picoband™
Question
We are interested in to test anti-MGA antibody PB9873 on human brain for research purposes, then I may be interested in using anti-MGA antibody PB9873 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2020-03-18
Answer
The products we sell, including anti-MGA antibody PB9873, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2020-03-18
Question
Is this PB9873 anti-MGA antibody reactive to the isotypes of MGA?
D. Anderson
Verified customer
Asked: 2019-07-08
Answer
The immunogen of PB9873 anti-MGA antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human MGA (2376-2415aa QKEAEAFAYYRRTHTANERRRRGEMRDLFEKLKITLGLLH), different from the related mouse sequence by two amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-07-08
Question
I was wanting to use your anti-MGA antibody for WB for human brain on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human brain identification?
Verified Customer
Verified customer
Asked: 2019-01-01
Answer
You can see on the product datasheet, PB9873 anti-MGA antibody has been tested for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human brain in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-01-01
Question
We are currently using anti-MGA antibody PB9873 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on pig tissues as well?
C. Brown
Verified customer
Asked: 2018-04-26
Answer
The anti-MGA antibody (PB9873) has not been tested for cross reactivity specifically with pig tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2018-04-26
Question
Can you help my question with product PB9873, anti-MGA antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
L. Zhao
Verified customer
Asked: 2017-10-12
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9873 anti-MGA antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2017-10-12
Question
Will PB9873 anti-MGA antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
F. Moore
Verified customer
Asked: 2017-05-31
Answer
It shows on the product datasheet, PB9873 anti-MGA antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2017-05-31
Question
Is there a BSA free version of anti-MGA antibody PB9873 available?
W. Li
Verified customer
Asked: 2014-09-10
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-MGA antibody PB9873 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2014-09-10