Eotaxin-2 Human Recombinant Protein (CCL24)

CCL24/Eotaxin-2/MPIF-2 protein, Human

CCL24 Human Recombinant produced in E. coli is a single, non-glycosylated polypeptide chain containing 78 amino acids and having a molecular mass of 8.8 kDa. The CCL24 is purified by proprietary chromatographic techniques.

Product Info Summary

SKU: PROTO00175
Size: 5ug, 20ug, 1mg
Origin Species: Human
Source: Escherichia coli

Product Name

Eotaxin-2 Human Recombinant Protein (CCL24)

View all CCL24/Eotaxin-2/MPIF-2 recombinant proteins

SKU/Catalog Number

PROTO00175

Size

5ug, 20ug, 1mg

Description

CCL24 Human Recombinant produced in E. coli is a single, non-glycosylated polypeptide chain containing 78 amino acids and having a molecular mass of 8.8 kDa. The CCL24 is purified by proprietary chromatographic techniques.

Storage & Handling

Lyophilized Eotaxin-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL24 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Cite This Product

Eotaxin-2 Human Recombinant Protein (CCL24) (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO00175)

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

The CCL24 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride.

Purity

Greater than 97.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.

Predicted MW

13.134kDa

Reconstitution

It is recommended to reconstitute the lyophilized CCL24 Human Recombinant in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Amino Acid Sequence

VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCG DPKQEWV QRYMKNLDAKQKKASPRARAVA

Biological Activity

The activity is determined by the chemoattract of human PBE (peripheral blood eosinophils) at a concentration between 50-100 ng/ml corresponding to a Specific Activity of 10,000-20,000IU/mg.

Reconstitution

It is recommended to reconstitute the lyophilized CCL24 Human Recombinant in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Validation Images & Assay Conditions

Gene/Protein Information For CCL24 (Source: Uniprot.org, NCBI)

Gene Name

CCL24

Full Name

C-C motif chemokine 24

Weight

13.134kDa

Superfamily

intercrine beta (chemokine CC) family

Alternative Names

C-C motif chemokine 24; Small-inducible cytokine A24; Myeloid progenitor inhibitory factor 2; CK-beta-6; Eosinophil chemotactic protein 2; Eotaxin-2; CCL24; Ckb-6; MPIF2; MPIF-2; SCYA24; Eotaxin2; CCL-24 CCL24 Ckb-6, MPIF-2, MPIF2, SCYA24 C-C motif chemokine ligand 24 C-C motif chemokine 24|CK-beta-6|chemokine (C-C motif) ligand 24|eosinophil chemotactic protein 2|eotaxin-2|myeloid progenitor inhibitory factor 2|small inducible cytokine subfamily A (Cys-Cys), member 24|small-inducible cytokine A24

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CCL24, check out the CCL24 Infographic

CCL24 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CCL24: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO00175

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Eotaxin-2 Human Recombinant Protein (CCL24)?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Eotaxin-2 Human Recombinant Protein (CCL24)

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Eotaxin-2 Human Recombinant Protein (CCL24)

Size

Total: $250

SKU:PROTO00175

Backordered.

Lead time for this item is typically 10-14 days

Get A Quote
In stock
Order Product
PROTO00175
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.