Cytohesin 3 (CYTH3) (NM_004227) Human Recombinant Protein

Cytohesin 3 protein,

Product Info Summary

SKU: PROTO43739
Size: 20 µg
Source: HEK293T

Product Name

Cytohesin 3 (CYTH3) (NM_004227) Human Recombinant Protein

View all Cytohesin 3 recombinant proteins

SKU/Catalog Number

PROTO43739

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cytohesin 3 (CYTH3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Cytohesin 3 (CYTH3) (NM_004227) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO43739)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

46.1 kDa

Amino Acid Sequence

MDEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERDEFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFIAMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK

Validation Images & Assay Conditions

Gene/Protein Information For CYTH3 (Source: Uniprot.org, NCBI)

Gene Name

CYTH3

Full Name

Cytohesin-3

Weight

46.1 kDa

Alternative Names

ARF nucleotide-binding site opener 3; ARNO3PH, SEC7 and coiled-coil domain-containing protein 3; cytohesin 3; General receptor of phosphoinositides 1; Grp1; GRP1cytohesin-3; pleckstrin homology, Sec7 and coiled-coil domains 3; Protein ARNO3; PSCD3pleckstrin homology, Sec7 and coiled/coil domains 3 CYTH3 ARNO3, GRP1, PSCD3, cytohesin-3 cytohesin 3 cytohesin-3|ARF nucleotide-binding site opener 3|PH, SEC7 and coiled-coil domain-containing protein 3|general receptor of phosphoinositides 1|pleckstrin homology, Sec7 and coiled-coil domains 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CYTH3, check out the CYTH3 Infographic

CYTH3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CYTH3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO43739

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Cytohesin 3 (CYTH3) (NM_004227) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Cytohesin 3 (CYTH3) (NM_004227) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Cytohesin 3 (CYTH3) (NM_004227) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO43739
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.