CUG BP1 (CELF1) (NM_198700) Human Recombinant Protein

CUGBP1/CELF1 protein,

Recombinant protein of human CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 2

Product Info Summary

SKU: PROTQ92879
Size: 20 µg
Source: HEK293T

Product Name

CUG BP1 (CELF1) (NM_198700) Human Recombinant Protein

View all CUGBP1/CELF1 recombinant proteins

SKU/Catalog Number

PROTQ92879

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CUG BP1 (CELF1) (NM_198700) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ92879)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

51.4 kDa

Amino Acid Sequence

MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY

Validation Images & Assay Conditions

Gene/Protein Information For CELF1 (Source: Uniprot.org, NCBI)

Gene Name

CELF1

Full Name

CUGBP Elav-like family member 1

Weight

51.4 kDa

Superfamily

CELF/BRUNOL family

Alternative Names

BRUNOL2; BRUNOL250 kDa nuclear polyadenylated RNA-binding protein; bruno-like 2; Bruno-like protein 2; CELF1; CUG RNA-binding protein; CUG triplet repeat, RNA binding protein 1; CUG triplet repeat, RNA-binding protein 1; CUG-BP- and ETR-3-like factor 1; CUGBP Elav-like family member 1; CUG-BP; CUGBP, Elav-like family member 1; CUGBP1; CUG-BP1; CUGBP1CUG triplet repeat RNA-binding protein 1; CUGBPCELF-1; D2Wsu101e; Deadenylation factor CUG-BP; EDEN-BP homolog; EDEN-BP; embryo deadenylation element binding protein; Embryo deadenylation element-binding protein homolog; HNAB50; NAB50; NAB50CUG-BP1 CELF1 BRUNOL2, CUG-BP, CUGBP, CUGBP1, EDEN-BP, NAB50, NAPOR, hNab50 CUGBP Elav-like family member 1 CUGBP Elav-like family member 1|50 kDa nuclear polyadenylated RNA-binding protein|CUG RNA-binding protein|CUG triplet repeat RNA-binding protein 1|CUG-BP- and ETR-3-like factor 1|EDEN-BP homolog|RNA-binding protein BRUNOL-2|bruno-like 2|bruno-like protein 2|deadenylation factor CUG-BP|embryo deadenylation element binding protein|embryo deadenylation element-binding protein homolog|nuclear polyadenylated RNA-binding protein, 50-kD

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CELF1, check out the CELF1 Infographic

CELF1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CELF1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ92879

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CUG BP1 (CELF1) (NM_198700) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CUG BP1 (CELF1) (NM_198700) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CUG BP1 (CELF1) (NM_198700) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ92879
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.