CSRP1 (NM_004078) Human Recombinant Protein

CSRP1 protein,

Recombinant protein of human cysteine and glycine-rich protein 1 (CSRP1), transcript variant 1

Product Info Summary

SKU: PROTP21291
Size: 20 µg
Source: HEK293T

Product Name

CSRP1 (NM_004078) Human Recombinant Protein

View all CSRP1 recombinant proteins

SKU/Catalog Number

PROTP21291

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cysteine and glycine-rich protein 1 (CSRP1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CSRP1 (NM_004078) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP21291)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.4 kDa

Amino Acid Sequence

MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE

Validation Images & Assay Conditions

Gene/Protein Information For CSRP1 (Source: Uniprot.org, NCBI)

Gene Name

CSRP1

Full Name

Cysteine and glycine-rich protein 1

Weight

20.4 kDa

Alternative Names

CRP; CRP1; CSRP1; CSRPCYRP; CYRP; cysteine and glycine-rich protein 1; Cysteine-rich protein 1; D1S181E; DKFZp686M148; LIM-domain protein CSRP1 CRP, CRP1, CSRP, CYRP, D1S181E, HEL-141, HEL-S-286 cysteine and glycine rich protein 1 cysteine and glycine-rich protein 1|LIM-domain protein|cysteine-rich protein 1|epididymis luminal protein 141|epididymis secretory protein Li 286|epididymis secretory sperm binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CSRP1, check out the CSRP1 Infographic

CSRP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CSRP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP21291

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CSRP1 (NM_004078) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CSRP1 (NM_004078) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CSRP1 (NM_004078) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP21291
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.