CSRP2 (NM_001321) Human Recombinant Protein

CSRP2 protein,

Product Info Summary

SKU: PROTQ16527
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CSRP2 (NM_001321) Human Recombinant Protein

View all CSRP2 recombinant proteins

SKU/Catalog Number

PROTQ16527

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cysteine and glycine-rich protein 2 (CSRP2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CSRP2 (NM_001321) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ16527)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.8 kDa

Amino Acid Sequence

MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ

Validation Images & Assay Conditions

Gene/Protein Information For CSRP2 (Source: Uniprot.org, NCBI)

Gene Name

CSRP2

Full Name

Cysteine and glycine-rich protein 2

Weight

20.8 kDa

Alternative Names

CRP2; CRP2LIM domain only protein 5; CSRP2; cysteine and glycine-rich protein 2; Cysteine-rich protein 2; LMO5LMO-5; SmLIM; SmLIMLIM domain only 5, smooth muscle; Smooth muscle cell LIM protein CSRP2 CRP2, LMO5, SmLIM cysteine and glycine rich protein 2 cysteine and glycine-rich protein 2|LIM domain only 5, smooth muscle|LIM domain only protein 5|LMO-5|cysteine-rich protein 2|epididymis secretory sperm binding protein|smooth muscle cell LIM protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CSRP2, check out the CSRP2 Infographic

CSRP2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CSRP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ16527

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CSRP2 (NM_001321) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CSRP2 (NM_001321) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CSRP2 (NM_001321) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ16527
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.