HS3ST1 (NM_005114) Human Recombinant Protein

Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 protein,

Product Info Summary

SKU: PROTO14792
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

HS3ST1 (NM_005114) Human Recombinant Protein

View all Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 recombinant proteins

SKU/Catalog Number

PROTO14792

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human heparan sulfate (glucosamine) 3-O-sulfotransferase 1 (HS3ST1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HS3ST1 (NM_005114) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO14792)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

33.7 kDa

Amino Acid Sequence

MAALLLGAVLLVAQPQLVPSRTAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH

Validation Images & Assay Conditions

Gene/Protein Information For HS3ST1 (Source: Uniprot.org, NCBI)

Gene Name

HS3ST1

Full Name

Heparan sulfate glucosamine 3-O-sulfotransferase 1

Weight

33.7 kDa

Superfamily

sulfotransferase 1 family

Alternative Names

3OST; 3OST1; 3-OST-1; 3OST1Heparan sulfate 3-O-sulfotransferase 1; EC 2.8.2; EC 2.8.2.23; h3-OST-1; heparan sulfate (glucosamine) 3-O-sulfotransferase 1; Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 1; heparan sulfate glucosamine 3-O-sulfotransferase 1; heparin-glucosamine 3-O-sulfotransferase; HS3ST1 HS3ST1 3OST, 3OST1 heparan sulfate-glucosamine 3-sulfotransferase 1 heparan sulfate glucosamine 3-O-sulfotransferase 1|3-OST-1|h3-OST-1|heparan sulfate (glucosamine) 3-O-sulfotransferase 1|heparan sulfate 3-O-sulfotransferase 1|heparan sulfate D-glucosaminyl 3-O-sulfotransferase 1|heparin-glucosamine 3-O-sulfotransferase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HS3ST1, check out the HS3ST1 Infographic

HS3ST1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HS3ST1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO14792

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HS3ST1 (NM_005114) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HS3ST1 (NM_005114) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HS3ST1 (NM_005114) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO14792
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product