CD36 (NM_001127443) Human Recombinant Protein

CD36/SR-B3 protein,

Product Info Summary

SKU: PROTP16671
Size: 20 µg
Source: HEK293T

Product Name

CD36 (NM_001127443) Human Recombinant Protein

View all CD36/SR-B3 recombinant proteins

SKU/Catalog Number

PROTP16671

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens CD36 molecule (thrombospondin receptor) (CD36), transcript variant 4

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CD36 (NM_001127443) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP16671)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

52.9 kDa

Amino Acid Sequence

MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For CD36 (Source: Uniprot.org, NCBI)

Gene Name

CD36

Full Name

Platelet glycoprotein 4

Weight

52.9 kDa

Superfamily

CD36 family

Alternative Names

CD36 antigen; CD36 molecule (thrombospondin receptor); CD36; Collagen R; FA6-152; FAT; FATCHDS7; Fatty acid translocase; Glycoprotein IIIb; GP3Bthrombospondin receptor); GPIIIb; GPIV; Leukocyte differentiation antigen CD36; PAS IV; PAS-4; Platelet collagen receptor; platelet glycoprotein 4; Platelet glycoprotein IV; SCARB3; scavenger receptor class B, member 3; SRB3; SR-B3; Thrombospondin R; Thrombospondin receptor CD36 BDPLT10, CHDS7, FAT, GP3B, GP4, GPIV, PASIV, SCARB3 CD36 molecule platelet glycoprotein 4|CD36 (collagen type I receptor, thrombospondin receptor)|CD36 molecule (thrombospondin receptor)|GPIIIB|PAS IV|PAS-4 protein|cluster determinant 36|fatty acid translocase|glycoprotein IIIb|leukocyte differentiation CD36|platelet glycoprotein IV|scavenger receptor class B, member 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CD36, check out the CD36 Infographic

CD36 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CD36: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP16671

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CD36 (NM_001127443) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CD36 (NM_001127443) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CD36 (NM_001127443) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP16671
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.