Click image to see more details
Product Info Summary
| SKU: | A00153-3 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | Flow Cytometry, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Nanog Antibody Picoband®
SKU/Catalog Number
A00153-3
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Nanog Antibody Picoband® catalog # A00153-3. Tested in Flow Cytometry, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Nanog Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00153-3)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Nanog, different from the related mouse sequence by three amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00153-3 is reactive to NANOG in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
48 kDa
Calculated molecular weight
34620 MW
Background of Nanog
NANOG (pron. nanOg) is a transcription factor critically involved with self-renewal of undifferentiated embryonic stem cells. In humans, this protein is encoded by the NANOG gene. It is mapped to 12p13.31. NANOG is thought to be a key factor in maintaining pluripotency. Moreover, NANOG is also thought to function in concert with other factors such as POU5F1 (Oct-4) and SOX2 to establish ESC identity. The NANOG protein has been found to be a transcriptional activator for the Rex1 promoter, playing a key role in sustaining Rex1 expression. Knockdown of NANOG in embryonic stem cells results in a reduction of Rex1 expression, while forced expression of NANOG stimulates Rex1 expression.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00153-3 is guaranteed for Flow Cytometry, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human
Positive Control
WB: rat ovary tissue, mouse ovary tissue, MCF-7 whole cell
FCM: A549 cell, PC-3 cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of Nanog using anti-Nanog antibody (A00153-3).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat ovary tissue lysates,
Lane 2: mouse ovary tissue lysates,
Lane 3: MCF-7 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Nanog antigen affinity purified polyclonal antibody (Catalog # A00153-3) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Nanog at approximately 48KD. The expected band size for Nanog is at 34KD.
Click image to see more details
Figure 2. Flow Cytometry analysis of A549 cells using anti-Nanog antibody (A00153-3).
Overlay histogram showing A549 cells stained with A00153-3 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Nanog Antibody (A00153-3,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Click image to see more details
Figure 3. Flow Cytometry analysis of PC-3 cells using anti-Nanog antibody (A00153-3).
Overlay histogram showing PC-3 cells stained with A00153-3 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Nanog Antibody (A00153-3,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Protein Target Info & Infographic
Gene/Protein Information For NANOG (Source: Uniprot.org, NCBI)
Gene Name
NANOG
Full Name
Homeobox protein NANOG
Weight
34620 MW
Superfamily
Nanog homeobox family
Alternative Names
Homeobox protein NANOG;Homeobox transcription factor Nanog;hNanog;NANOG; Nanog|2410002E02Rik, EN, ENK, ecat, ecat4|Nanog homeobox|homeobox protein NANOG|ES cell-associated protein 4|early embryo specific expression NK family|early embryo specific expression NK-type homeobox protein|homeobox transcription factor Nanog
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on NANOG, check out the NANOG Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for NANOG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Nanog Antibody Picoband® (A00153-3)
Hello CJ!
A00153-3 has been cited in 1 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
LncRNA LINC00662 Exerts an Oncogenic Effect on Osteosarcoma by the miR-16-5p/ITPR1 Axis
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Nanog Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Nanog Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-Nanog Antibody Picoband®
Question
Do you have a BSA free version of anti-Nanog antibody A00153-3 available?
Verified Customer
Verified customer
Asked: 2020-04-14
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-Nanog antibody A00153-3 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-04-14
Question
Would A00153-3 anti-Nanog antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-03-20
Answer
As indicated on the product datasheet, A00153-3 anti-Nanog antibody as been validated on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-03-20
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for teratocarcinoma using anti-Nanog antibody A00153-3. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2020-01-24
Answer
Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-01-24
Question
I see that the anti-Nanog antibody A00153-3 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-12-03
Answer
You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-12-03
Question
Is a blocking peptide available for product anti-Nanog antibody (A00153-3)?
Verified Customer
Verified customer
Asked: 2019-11-28
Answer
We do provide the blocking peptide for product anti-Nanog antibody (A00153-3). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-11-28
Question
My colleagues were satisfied with the WB result of your anti-Nanog antibody. However we have observed positive staining in embryonic stem cell nucleus using this antibody. Is that expected? Could you tell me where is NANOG supposed to be expressed?
A. Johnson
Verified customer
Asked: 2019-10-22
Answer
From what I have seen in literature, embryonic stem cell does express NANOG. Generally NANOG expresses in nucleus. Regarding which tissues have NANOG expression, here are a few articles citing expression in various tissues:
Embryonic stem cell, Pubmed ID: 12787504, 14990856, 16391521
Teratocarcinoma, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2019-10-22
Question
I am interested in using your anti-Nanog antibody for sox2 studies. Has this antibody been tested with western blotting on a549 cells? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2019-08-19
Answer
Thank you for your inquiry. This A00153-3 anti-Nanog antibody is tested on a549 cells. It is guaranteed to work for Flow Cytometry, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2019-08-19
Question
We have seen staining in human teratocarcinoma. Are there any suggestions? Is anti-Nanog antibody supposed to stain teratocarcinoma positively?
Verified Customer
Verified customer
Asked: 2019-06-28
Answer
From what I have seen in literature teratocarcinoma does express NANOG. From what I have seen in Uniprot.org, NANOG is expressed in cerebellar vermis, embryonic stem cell, teratocarcinoma, among other tissues. Regarding which tissues have NANOG expression, here are a few articles citing expression in various tissues:
Embryonic stem cell, Pubmed ID: 12787504, 14990856, 16391521
Teratocarcinoma, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2019-06-28
Question
Is this A00153-3 anti-Nanog antibody reactive to the isotypes of NANOG?
B. Jackson
Verified customer
Asked: 2019-06-28
Answer
The immunogen of A00153-3 anti-Nanog antibody is A synthetic peptide corresponding to a sequence in the middle region of human Nanog (115-155aa QRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQK), different from the related mouse sequence by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-06-28
Question
See below the WB image, lot number and protocol we used for teratocarcinoma using anti-Nanog antibody A00153-3. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-06-24
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-06-24
Question
We are currently using anti-Nanog antibody A00153-3 for rat tissue, and we are happy with the Flow Cytometry results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on dog tissues as well?
A. Parker
Verified customer
Asked: 2017-10-06
Answer
The anti-Nanog antibody (A00153-3) has not been validated for cross reactivity specifically with dog tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2017-10-06
Question
I am interested in to test anti-Nanog antibody A00153-3 on rat teratocarcinoma for research purposes, then I may be interested in using anti-Nanog antibody A00153-3 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
J. Wu
Verified customer
Asked: 2017-07-07
Answer
The products we sell, including anti-Nanog antibody A00153-3, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2017-07-07
Question
Would anti-Nanog antibody A00153-3 work for Flow Cytometry with teratocarcinoma?
E. Mangal
Verified customer
Asked: 2017-04-03
Answer
According to the expression profile of teratocarcinoma, NANOG is highly expressed in teratocarcinoma. So, it is likely that anti-Nanog antibody A00153-3 will work for Flow Cytometry with teratocarcinoma.
Boster Scientific Support
Answered: 2017-04-03
Question
My question regarding product A00153-3, anti-Nanog antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
A. Collins
Verified customer
Asked: 2016-12-28
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00153-3 anti-Nanog antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2016-12-28
Question
I was wanting to use your anti-Nanog antibody for Flow Cytometry for rat teratocarcinoma on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat teratocarcinoma identification?
N. Williams
Verified customer
Asked: 2016-12-21
Answer
As indicated on the product datasheet, A00153-3 anti-Nanog antibody has been validated for Flow Cytometry, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat teratocarcinoma in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2016-12-21
Question
Our lab used your anti-Nanog antibody for WB on cerebellar vermis in a previous project. I am using human, and We want to use the antibody for Flow Cytometry next. Our lab want to know about examining cerebellar vermis as well as teratocarcinoma in our next experiment. Could you please give me some suggestion on which antibody would work the best for Flow Cytometry?
S. Baker
Verified customer
Asked: 2015-08-17
Answer
I have checked the website and datasheets of our anti-Nanog antibody and it seems that A00153-3 has been validated on human in both WB and Flow Cytometry. Thus A00153-3 should work for your application. Our Boster satisfaction guarantee will cover this product for Flow Cytometry in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for Flow Cytometry detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2015-08-17
