Click image to see more details
Product Info Summary
| SKU: | PB9667 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Rat |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-MEFV Antibody Picoband®
SKU/Catalog Number
PB9667
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-MEFV Antibody Picoband® catalog # PB9667. Tested in WB applications. This antibody reacts with Human, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-MEFV Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9667)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human MEFV, different from the related mouse sequence by eight amino acids, and from the related rat sequence by eleven amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9667 is reactive to MEFV in Human, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
86 kDa
Calculated molecular weight
86444 MW
Background of MEFV
MEFV (Mediterranean fever) is a human gene that provides instructions for making a protein called pyrin (also known as marenostrin). Pyrin is produced in certain white blood cells (neutrophils, eosinophils and monocytes) that play a role in inflammation and in fighting infection. Inside these white blood cells, pyrin is found with thecytoskeleton, the structural framework that helps to define the shape, size, and movement of a cell. Pyrin's protein structure also allows it to interact with other molecules involved in fighting infection and in the inflammatory response. Although pyrin's function is not fully understood, it likely assists in keeping the inflammation process under control. Research indicates that pyrin helps regulate inflammation by interacting with the cytoskeleton. And Pyrin may direct the migration of white blood cells to sites of inflammation and stop or slow the inflammatory response when it is no longer needed.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9667 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Rat
Positive Control
WB: Rat Spleen Tissue, Rat Lung Tissue, HEPA Whole Cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of MEFV using anti-MEFV antibody (PB9667).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours.
Lane 1: Rat Spleen Tissue Lysate at 50ug,
Lane 2: Rat Lung Tissue Lysate at 50ug,
Lane 3: HEPA Whole Cell Lysate at 40ug.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MEFV antigen affinity purified polyclonal antibody (Catalog # PB9667) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for MEFV at approximately 86 kDa. The expected band size for MEFV is at 86 kDa.
Protein Target Info & Infographic
Gene/Protein Information For MEFV (Source: Uniprot.org, NCBI)
Gene Name
MEFV
Full Name
Pyrin
Weight
86444 MW
Alternative Names
Pyrin;Marenostrin;MEFV;MEF, TRIM20 ; MEFV FMF, MEF, PAAND, TRIM20 MEFV innate immuity regulator, pyrin pyrin|MEFV, pyrin innate immunity regulator|Mediterranean fever|marenostrin
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on MEFV, check out the MEFV Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for MEFV: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-MEFV Antibody Picoband® (PB9667)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-MEFV Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-MEFV Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
6 Customer Q&As for Anti-MEFV Antibody Picoband®
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for placenta using anti-MEFV antibody PB9667. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2020-03-13
Answer
Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-03-13
Question
Is this PB9667 anti-MEFV antibody reactive to the isotypes of MEFV?
Verified Customer
Verified customer
Asked: 2020-03-05
Answer
The immunogen of PB9667 anti-MEFV antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human MEFV(5-39aa PSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSR), different from the related mouse sequence by eight amino acids, and from the related rat sequence by eleven amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-03-05
Question
My question regarding product PB9667, anti-MEFV antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
M. Yang
Verified customer
Asked: 2020-02-04
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9667 anti-MEFV antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2020-02-04
Question
Will PB9667 anti-MEFV antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-12-27
Answer
It shows on the product datasheet, PB9667 anti-MEFV antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-12-27
Question
Is a blocking peptide available for product anti-MEFV antibody (PB9667)?
A. Bhatt
Verified customer
Asked: 2019-06-04
Answer
We do provide the blocking peptide for product anti-MEFV antibody (PB9667). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-06-04
Question
We are currently using anti-MEFV antibody PB9667 for rat tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, rat. Is it true that the antibody can work on horse tissues as well?
Verified Customer
Verified customer
Asked: 2019-05-01
Answer
The anti-MEFV antibody (PB9667) has not been tested for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-05-01
