Anti-LRIG1 Antibody Picoband™

Lrig1 antibody

Boster Bio Anti-LRIG1 Antibody Picoband™ catalog # A04613-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A04613-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-LRIG1 Antibody Picoband™

View all Lrig1 Antibodies

SKU/Catalog Number

A04613-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-LRIG1 Antibody Picoband™ catalog # A04613-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-LRIG1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04613-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of mouse LRIG1, which shares 90% amino acid (aa) sequence identity with human LRIG1.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A04613-1 is reactive to Lrig1 in Human, Mouse, Rat

Applications

A04613-1 is guaranteed for IHC, WB Boster Guarantee

Observed Molecular Weight

145 kDa

Calculated molecular weight

Background of Lrig1

Leucine-rich repeats and immunoglobulin-like domains protein 1 is a protein that in humans is encoded by the LRIG1 gene. It is mapped to 3p14.1. Leucine-rich repeats and immunoglobulin-like domains protein 1 is a protein that in humans is encoded by the LRIG1 gene. It encodes a transmembrane protein that has been shown to interact with receptor tyrosine kinases of the EGFR-family, MET and RET. This gene encodes a member of the ATP-dependent DNA ligase protein family. The encoded protein functions in DNA replication, recombination, and the base excision repair process. Mutations in this gene that lead to DNA ligase I deficiency result in immunodeficiency and increased sensitivity to DNA-damaging agents. Disruption of this gene may also be associated with a variety of cancers. Alternative splicing results in multiple transcript variants.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For Lrig1 (Source: Uniprot.org, NCBI)

Gene Name

Lrig1

Full Name

Leucine-rich repeats and immunoglobulin-like domains protein 1

Weight

Alternative Names

D6Bwg0781e; Img; LIG1; LIG-1; LRIG1 Lrig1|D6Bwg0781e, Im, Img, LIG, LIG-1|leucine-rich repeats and immunoglobulin-like domains 1|leucine-rich repeats and immunoglobulin-like domains protein 1|integral membrane glycoprotein

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on Lrig1, check out the Lrig1 Infographic

Lrig1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Lrig1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A04613-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-LRIG1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-LRIG1 Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

13 Customer Q&As for Anti-LRIG1 Antibody Picoband™

Question

We are currently using anti-LRIG1 antibody A04613-1 for mouse tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on goat tissues as well?

Verified Customer

Verified customer

Asked: 2020-04-20

Answer

The anti-LRIG1 antibody (A04613-1) has not been validated for cross reactivity specifically with goat tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-04-20

Question

We want to test anti-LRIG1 antibody A04613-1 on rat uterus for research purposes, then I may be interested in using anti-LRIG1 antibody A04613-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2020-03-11

Answer

The products we sell, including anti-LRIG1 antibody A04613-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-03-11

Question

Would A04613-1 anti-LRIG1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2020-02-28

Answer

You can see on the product datasheet, A04613-1 anti-LRIG1 antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-02-28

Question

Does anti-LRIG1 antibody A04613-1 work on pig WB with lymph placenta?

E. Singh

Verified customer

Asked: 2020-01-28

Answer

Our lab technicians have not validated anti-LRIG1 antibody A04613-1 on pig. You can run a BLAST between pig and the immunogen sequence of anti-LRIG1 antibody A04613-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated pig samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in pig lymph placenta in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-01-28

Question

I was wanting to use your anti-LRIG1 antibody for IHC for rat uterus on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat uterus identification?

Verified Customer

Verified customer

Asked: 2019-05-27

Answer

You can see on the product datasheet, A04613-1 anti-LRIG1 antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat uterus in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-05-27

Question

Is a blocking peptide available for product anti-LRIG1 antibody (A04613-1)?

Verified Customer

Verified customer

Asked: 2018-11-14

Answer

We do provide the blocking peptide for product anti-LRIG1 antibody (A04613-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2018-11-14

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for uterus using anti-LRIG1 antibody A04613-1. Let me know if you need anything else.

A. Zhao

Verified customer

Asked: 2018-08-13

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-08-13

Question

I see that the anti-LRIG1 antibody A04613-1 works with IHC, what is the protocol used to produce the result images on the product page?

P. Lewis

Verified customer

Asked: 2018-08-02

Answer

You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2018-08-02

Question

I have a question about product A04613-1, anti-LRIG1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-07-12

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A04613-1 anti-LRIG1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-07-12

Question

Is this A04613-1 anti-LRIG1 antibody reactive to the isotypes of LRIG1?

A. Williams

Verified customer

Asked: 2016-03-09

Answer

The immunogen of A04613-1 anti-LRIG1 antibody is A synthetic peptide corresponding to a sequence of human LRIG1 (AKRAFSGLESLEHLNLGENAIRSVQFDAFAKMKNLKELYI). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2016-03-09

Question

See below the WB image, lot number and protocol we used for uterus using anti-LRIG1 antibody A04613-1. Please let me know if you require anything else.

D. Li

Verified customer

Asked: 2016-03-07

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2016-03-07

Question

Does anti-LRIG1 antibody A04613-1 work for IHC with uterus?

R. Li

Verified customer

Asked: 2015-08-19

Answer

According to the expression profile of uterus, LRIG1 is highly expressed in uterus. So, it is likely that anti-LRIG1 antibody A04613-1 will work for IHC with uterus.

Boster Scientific Support

Answered: 2015-08-19

Question

Do you have a BSA free version of anti-LRIG1 antibody A04613-1 available?

P. Miller

Verified customer

Asked: 2014-08-15

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-LRIG1 antibody A04613-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2014-08-15

Order DetailsPrice
A04613-1

100μg

$370
A04613-1-10ug

10μg sample (liquid)

$99
A04613-1-Biotin

100 μg Biotin conjugated

$570
A04613-1-Cy3

100 μg Cy3 conjugated

$570
A04613-1-Dylight488

100 μg Dylight488 conjugated

$570
A04613-1-Dylight550

100 μg Dylight550 conjugated

$570
A04613-1-Dylight594

100 μg Dylight594 conjugated

$570
A04613-1-FITC

100 μg FITC conjugated

$570
A04613-1-HRP

100 μg HRP conjugated

$570
A04613-1-APC

100 μg APC conjugated

$670
A04613-1-PE

100 μg PE conjugated

$670
A04613-1-iFluor647

100 μg iFluor647 conjugated

$670
A04613-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A04613-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.