Product Info Summary
SKU: | A04613-1 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-LRIG1 Antibody Picoband™
SKU/Catalog Number
A04613-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-LRIG1 Antibody Picoband™ catalog # A04613-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-LRIG1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04613-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of mouse LRIG1, which shares 90% amino acid (aa) sequence identity with human LRIG1.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A04613-1 is reactive to Lrig1 in Human, Mouse, Rat
Applications
A04613-1 is guaranteed for IHC, WB Boster Guarantee
Observed Molecular Weight
145 kDa
Calculated molecular weight
Background of Lrig1
Leucine-rich repeats and immunoglobulin-like domains protein 1 is a protein that in humans is encoded by the LRIG1 gene. It is mapped to 3p14.1. Leucine-rich repeats and immunoglobulin-like domains protein 1 is a protein that in humans is encoded by the LRIG1 gene. It encodes a transmembrane protein that has been shown to interact with receptor tyrosine kinases of the EGFR-family, MET and RET. This gene encodes a member of the ATP-dependent DNA ligase protein family. The encoded protein functions in DNA replication, recombination, and the base excision repair process. Mutations in this gene that lead to DNA ligase I deficiency result in immunodeficiency and increased sensitivity to DNA-damaging agents. Disruption of this gene may also be associated with a variety of cancers. Alternative splicing results in multiple transcript variants.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Validation Images & Assay Conditions
![A04613 1 LRIG1 primary antibodies WB testing 1 A04613 1 LRIG1 primary antibodies WB testing 1](https://www.bosterbio.com/media/catalog/product/A/0/A04613-1-LRIG1-primary-antibodies-WB-testing-1.jpg)
Click image to see more details
Figure 1. Western blot analysis of LRIG1 using anti-LRIG1 antibody (A04613-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human Caco-2 whole cell lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-LRIG1 antigen affinity purified polyclonal antibody (Catalog # A04613-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for LRIG1 at approximately 145KD. The expected band size for LRIG1 is at 119KD.
![A04613 1 LRIG1 primary antibodies IHC testing 2 A04613 1 LRIG1 primary antibodies IHC testing 2](https://www.bosterbio.com/media/catalog/product/A/0/A04613-1-LRIG1-primary-antibodies-IHC-testing-2.jpg)
Click image to see more details
Figure 2. IHC analysis of LRIG1 using anti-LRIG1 antibody (A04613-1).
LRIG1 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-LRIG1 Antibody (A04613-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For Lrig1 (Source: Uniprot.org, NCBI)
Gene Name
Lrig1
Full Name
Leucine-rich repeats and immunoglobulin-like domains protein 1
Weight
Alternative Names
D6Bwg0781e; Img; LIG1; LIG-1; LRIG1 Lrig1|D6Bwg0781e, Im, Img, LIG, LIG-1|leucine-rich repeats and immunoglobulin-like domains 1|leucine-rich repeats and immunoglobulin-like domains protein 1|integral membrane glycoprotein
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on Lrig1, check out the Lrig1 Infographic
![Lrig1 infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for Lrig1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-LRIG1 Antibody Picoband™ (A04613-1)
Hello CJ!
No publications found for A04613-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-LRIG1 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-LRIG1 Antibody Picoband™
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
13 Customer Q&As for Anti-LRIG1 Antibody Picoband™
Question
We are currently using anti-LRIG1 antibody A04613-1 for mouse tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on goat tissues as well?
Verified Customer
Verified customer
Asked: 2020-04-20
Answer
The anti-LRIG1 antibody (A04613-1) has not been validated for cross reactivity specifically with goat tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-04-20
Question
We want to test anti-LRIG1 antibody A04613-1 on rat uterus for research purposes, then I may be interested in using anti-LRIG1 antibody A04613-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2020-03-11
Answer
The products we sell, including anti-LRIG1 antibody A04613-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2020-03-11
Question
Would A04613-1 anti-LRIG1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-02-28
Answer
You can see on the product datasheet, A04613-1 anti-LRIG1 antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-02-28
Question
Does anti-LRIG1 antibody A04613-1 work on pig WB with lymph placenta?
E. Singh
Verified customer
Asked: 2020-01-28
Answer
Our lab technicians have not validated anti-LRIG1 antibody A04613-1 on pig. You can run a BLAST between pig and the immunogen sequence of anti-LRIG1 antibody A04613-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated pig samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in pig lymph placenta in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-01-28
Question
I was wanting to use your anti-LRIG1 antibody for IHC for rat uterus on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat uterus identification?
Verified Customer
Verified customer
Asked: 2019-05-27
Answer
You can see on the product datasheet, A04613-1 anti-LRIG1 antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat uterus in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-05-27
Question
Is a blocking peptide available for product anti-LRIG1 antibody (A04613-1)?
Verified Customer
Verified customer
Asked: 2018-11-14
Answer
We do provide the blocking peptide for product anti-LRIG1 antibody (A04613-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2018-11-14
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for uterus using anti-LRIG1 antibody A04613-1. Let me know if you need anything else.
A. Zhao
Verified customer
Asked: 2018-08-13
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-08-13
Question
I see that the anti-LRIG1 antibody A04613-1 works with IHC, what is the protocol used to produce the result images on the product page?
P. Lewis
Verified customer
Asked: 2018-08-02
Answer
You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2018-08-02
Question
I have a question about product A04613-1, anti-LRIG1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2018-07-12
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A04613-1 anti-LRIG1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2018-07-12
Question
Is this A04613-1 anti-LRIG1 antibody reactive to the isotypes of LRIG1?
A. Williams
Verified customer
Asked: 2016-03-09
Answer
The immunogen of A04613-1 anti-LRIG1 antibody is A synthetic peptide corresponding to a sequence of human LRIG1 (AKRAFSGLESLEHLNLGENAIRSVQFDAFAKMKNLKELYI). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2016-03-09
Question
See below the WB image, lot number and protocol we used for uterus using anti-LRIG1 antibody A04613-1. Please let me know if you require anything else.
D. Li
Verified customer
Asked: 2016-03-07
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2016-03-07
Question
Does anti-LRIG1 antibody A04613-1 work for IHC with uterus?
R. Li
Verified customer
Asked: 2015-08-19
Answer
According to the expression profile of uterus, LRIG1 is highly expressed in uterus. So, it is likely that anti-LRIG1 antibody A04613-1 will work for IHC with uterus.
Boster Scientific Support
Answered: 2015-08-19
Question
Do you have a BSA free version of anti-LRIG1 antibody A04613-1 available?
P. Miller
Verified customer
Asked: 2014-08-15
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-LRIG1 antibody A04613-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2014-08-15