Click image to see more details
Product Info Summary
| SKU: | A01748-Dyl550 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | Flow Cytometry |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Human CCR3 DyLight® 550 conjugated Antibody
SKU/Catalog Number
A01748-Dyl550
Size
100 μg/vial
Form
Liquid
Description
Boster Bio Anti-Human CCR3 DyLight® 550 conjugated Antibody catalog # A01748-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.
Storage & Handling
At -20°C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.
Cite This Product
Anti-Human CCR3 DyLight® 550 conjugated Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01748-Dyl550)
Host
Rabbit
Contents
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human CCR3.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A01748-Dyl550 is reactive to CCR3 in Human
Reconstitution
Observed Molecular Weight
39 kDa
Calculated molecular weight
41.044kDa
Background of CCR3
C-C chemokine receptor type 3, also called CCR3 or CKR3 is a protein that in humans is encoded by the CCR3 gene. The protein encoded by this gene is a receptor for C-C type chemokines. It belongs to family 1 of the G protein-coupled receptors. This gene and seven other chemokine receptor genes form a chemokine receptor gene cluster on the chromosomal region 3p21. This receptor binds and responds to a variety of chemokines, including eotaxin (CCL11), eotaxin-3 (CCL26), MCP-3 (CCL7), MCP-4 (CCL13), and RANTES (CCL5). It is highly expressed in eosinophils and basophils, and is also detected in TH1 and TH2 cells, as well as in airway epithelial cells. This receptor may contribute to the accumulation and activation of eosinophils and other inflammatory cells in the allergic airway. It is also known to be an entry co-receptor for HIV-1. Alternatively spliced transcript variants have been described.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A01748-Dyl550 is guaranteed for Flow Cytometry Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Flow Cytometry (Fixed), 1-3μg/1x106 cells
Validation Images & Assay Conditions
Click image to see more details
Boster Kit Box
Protein Target Info & Infographic
Gene/Protein Information For CCR3 (Source: Uniprot.org, NCBI)
Gene Name
CCR3
Full Name
C-C chemokine receptor type 3
Weight
41.044kDa
Superfamily
G-protein coupled receptor 1 family
Alternative Names
C-C chemokine receptor type 3; C-C CKR-3; CC-CKR-3; CCR-3; CCR3; CKR3; Eosinophil eotaxin receptor; CD193; CCR3; CMKBR3 CCR3 C C CKR3, CC-CKR-3, CD193, CKR 3, CKR3, CMKBR3 C-C motif chemokine receptor 3 C-C chemokine receptor type 3|C-C CKR-3|CC chemokine receptor 3|CCR-3|b-chemokine receptor|chemokine (C-C motif) receptor 3|eosinophil CC chemokine receptor 3|eosinophil eotaxin receptor
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on CCR3, check out the CCR3 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CCR3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Human CCR3 DyLight® 550 conjugated Antibody (A01748-Dyl550)
Hello CJ!
No publications found for A01748-Dyl550
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Human CCR3 DyLight® 550 conjugated Antibody?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Human CCR3 DyLight® 550 conjugated Antibody
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
14 Customer Q&As for Anti-Human CCR3 DyLight® 550 conjugated Antibody
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for monocyte using anti-Human CCR3 DyLight® 550 conjugated antibody A01748-Dyl550. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2020-01-29
Answer
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-01-29
Question
We have been able to see staining in human monocyte. What should we do? Is anti-Human CCR3 DyLight® 550 conjugated antibody supposed to stain monocyte positively?
Verified Customer
Verified customer
Asked: 2019-10-01
Answer
According to literature monocyte does express CCR3. According to Uniprot.org, CCR3 is expressed in blood, monocyte, synovium, among other tissues. Regarding which tissues have CCR3 expression, here are a few articles citing expression in various tissues:
Blood, Pubmed ID: 15489334
Monocyte, Pubmed ID: 7622448
Synovium, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2019-10-01
Question
We were happy with the WB result of your anti-Human CCR3 DyLight® 550 conjugated antibody. However we have been able to see positive staining in synovium cell membrane using this antibody. Is that expected? Could you tell me where is CCR3 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-07-04
Answer
From what I have seen in literature, synovium does express CCR3. Generally CCR3 expresses in cell membrane. Regarding which tissues have CCR3 expression, here are a few articles citing expression in various tissues:
Blood, Pubmed ID: 15489334
Monocyte, Pubmed ID: 7622448
Synovium, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2019-07-04
Question
I was wanting to use your anti-Human CCR3 DyLight® 550 conjugated antibody for Flow Cytometry for human monocyte on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human monocyte identification?
T. Brown
Verified customer
Asked: 2019-02-08
Answer
You can see on the product datasheet, A01748-Dyl550 anti-Human CCR3 DyLight® 550 conjugated antibody has been validated for Flow Cytometry on human tissues. We have an innovator award program that if you test this antibody and show it works in human monocyte in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-02-08
Question
Does anti-Human CCR3 DyLight® 550 conjugated antibody A01748-Dyl550 work for Flow Cytometry with monocyte?
Verified Customer
Verified customer
Asked: 2018-11-16
Answer
According to the expression profile of monocyte, CCR3 is highly expressed in monocyte. So, it is likely that anti-Human CCR3 DyLight® 550 conjugated antibody A01748-Dyl550 will work for Flow Cytometry with monocyte.
Boster Scientific Support
Answered: 2018-11-16
Question
Does A01748-Dyl550 anti-Human CCR3 DyLight® 550 conjugated antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2018-10-09
Answer
As indicated on the product datasheet, A01748-Dyl550 anti-Human CCR3 DyLight® 550 conjugated antibody as been validated on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2018-10-09
Question
Is there a BSA free version of anti-Human CCR3 DyLight® 550 conjugated antibody A01748-Dyl550 available?
Verified Customer
Verified customer
Asked: 2018-04-18
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-Human CCR3 DyLight® 550 conjugated antibody A01748-Dyl550 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2018-04-18
Question
We want to test anti-Human CCR3 DyLight® 550 conjugated antibody A01748-Dyl550 on human monocyte for research purposes, then I may be interested in using anti-Human CCR3 DyLight® 550 conjugated antibody A01748-Dyl550 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2017-06-09
Answer
The products we sell, including anti-Human CCR3 DyLight® 550 conjugated antibody A01748-Dyl550, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2017-06-09
Question
Is this A01748-Dyl550 anti-Human CCR3 DyLight® 550 conjugated antibody reactive to the isotypes of CCR3?
Verified Customer
Verified customer
Asked: 2017-06-02
Answer
The immunogen of A01748-Dyl550 anti-Human CCR3 DyLight® 550 conjugated antibody is A synthetic peptide corresponding to a sequence of human CCR3 (MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMA). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2017-06-02
Question
Please see the WB image, lot number and protocol we used for monocyte using anti-Human CCR3 DyLight® 550 conjugated antibody A01748-Dyl550. Please let me know if you require anything else.
B. Dhar
Verified customer
Asked: 2017-01-30
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2017-01-30
Question
I see that the anti-Human CCR3 DyLight® 550 conjugated antibody A01748-Dyl550 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?
P. Krishna
Verified customer
Asked: 2014-02-27
Answer
You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2014-02-27
Question
My question regarding product A01748-Dyl550, anti-Human CCR3 DyLight® 550 conjugated antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
L. Roberts
Verified customer
Asked: 2014-01-15
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01748-Dyl550 anti-Human CCR3 DyLight® 550 conjugated antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2014-01-15
Question
Is a blocking peptide available for product anti-Human CCR3 DyLight® 550 conjugated antibody (A01748-Dyl550)?
P. Evans
Verified customer
Asked: 2013-03-21
Answer
We do provide the blocking peptide for product anti-Human CCR3 DyLight® 550 conjugated antibody (A01748-Dyl550). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2013-03-21
Question
We are currently using anti-Human CCR3 DyLight® 550 conjugated antibody A01748-Dyl550 for human tissue, and we are content with the Flow Cytometry results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on canine tissues as well?
P. Jha
Verified customer
Asked: 2013-01-08
Answer
The anti-Human CCR3 DyLight® 550 conjugated antibody (A01748-Dyl550) has not been validated for cross reactivity specifically with canine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2013-01-08
