Click image to see more details
Product Info Summary
| SKU: | A01748-1 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | Flow Cytometry, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-CCR3 Antibody Picoband®
SKU/Catalog Number
A01748-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-CCR3 Antibody Picoband® catalog # A01748-1. Tested in Flow Cytometry, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-CCR3 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01748-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human CCR3.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A01748-1 is reactive to CCR3 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
55 kDa
Calculated molecular weight
41.044kDa
Background of CCR3
C-C chemokine receptor type 3, also called CCR3 or CKR3 is a protein that in humans is encoded by the CCR3 gene. The protein encoded by this gene is a receptor for C-C type chemokines. It belongs to family 1 of the G protein-coupled receptors. This gene and seven other chemokine receptor genes form a chemokine receptor gene cluster on the chromosomal region 3p21. This receptor binds and responds to a variety of chemokines, including eotaxin (CCL11), eotaxin-3 (CCL26), MCP-3 (CCL7), MCP-4 (CCL13), and RANTES (CCL5). It is highly expressed in eosinophils and basophils, and is also detected in TH1 and TH2 cells, as well as in airway epithelial cells. This receptor may contribute to the accumulation and activation of eosinophils and other inflammatory cells in the allergic airway. It is also known to be an entry co-receptor for HIV-1. Alternatively spliced transcript variants have been described.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A01748-1 is guaranteed for Flow Cytometry, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Flow Cytometry (Fixed), 1-3μg/1x106 cells
Positive Control
WB: human Jurkat whole cell, human HepG2 whole cell, human MCF-7 whole cell, human U-87MG whole cell, human CCRF-CEM whole cell, rat brain tissue, mouse brain tissue, mouse testis tissue
FCM: RAW2647 cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of CCR3 using anti-CCR3 antibody (A01748-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human Jurkat whole cell lysates,
Lane 2: human HepG2 whole cell lysates,
Lane 3: human MCF-7 whole cell lysates,
Lane 4: human U-87MG whole cell lysates,
Lane 5: human CCRF-CEM whole cell lysates,
Lane 6: rat brain tissue lysates,
Lane 7: mouse brain tissue lysates,
Lane 8: mouse testis tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CCR3 antigen affinity purified polyclonal antibody (Catalog # A01748-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for CCR3 at approximately 55KD. The expected band size for CCR3 is at 41KD.
Click image to see more details
Figure 2. Flow Cytometry analysis of RAW264.7 cells using anti-CCR3 antibody (A01748-1).
Overlay histogram showing RAW264.7 cells stained with A01748-1 (Blue line). The cells were fixed with 4% paraformaldehyde and blocked with 10% normal goat serum. And then incubated with rabbit anti-CCR3 Antibody (A01748-1,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Protein Target Info & Infographic
Gene/Protein Information For CCR3 (Source: Uniprot.org, NCBI)
Gene Name
CCR3
Full Name
C-C chemokine receptor type 3
Weight
41.044kDa
Superfamily
G-protein coupled receptor 1 family
Alternative Names
C-C chemokine receptor type 3; C-C CKR-3; CC-CKR-3; CCR-3; CCR3; CKR3; Eosinophil eotaxin receptor; CD193; CCR3; CMKBR3 CCR3 C C CKR3, CC-CKR-3, CD193, CKR 3, CKR3, CMKBR3 C-C motif chemokine receptor 3 C-C chemokine receptor type 3|C-C CKR-3|CC chemokine receptor 3|CCR-3|b-chemokine receptor|chemokine (C-C motif) receptor 3|eosinophil CC chemokine receptor 3|eosinophil eotaxin receptor
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on CCR3, check out the CCR3 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CCR3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-CCR3 Antibody Picoband® (A01748-1)
Hello CJ!
No publications found for A01748-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-CCR3 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-CCR3 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-CCR3 Antibody Picoband®
Question
My team were satisfied with the WB result of your anti-CCR3 antibody. However we have observed positive staining in monocyte cell membrane using this antibody. Is that expected? Could you tell me where is CCR3 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2020-05-06
Answer
From what I have seen in literature, monocyte does express CCR3. Generally CCR3 expresses in cell membrane. Regarding which tissues have CCR3 expression, here are a few articles citing expression in various tissues:
Blood, Pubmed ID: 15489334
Monocyte, Pubmed ID: 7622448
Synovium, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2020-05-06
Question
My lab would like using your anti-CCR3 antibody for chemokine receptors bind chemokines studies. Has this antibody been tested with western blotting on mouse brain? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2020-02-20
Answer
I appreciate your inquiry. This A01748-1 anti-CCR3 antibody is tested on human hepg2 whole cell lysates, jurkat whole cell lysates, rat brain tissue, mouse brain, testis tissue, raw264.7 cells. It is guaranteed to work for Flow Cytometry, IHC, ICC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2020-02-20
Question
Will anti-CCR3 antibody A01748-1 work for IHC with monocyte?
Verified Customer
Verified customer
Asked: 2020-02-07
Answer
According to the expression profile of monocyte, CCR3 is highly expressed in monocyte. So, it is likely that anti-CCR3 antibody A01748-1 will work for IHC with monocyte.
Boster Scientific Support
Answered: 2020-02-07
Question
I see that the anti-CCR3 antibody A01748-1 works with IHC, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2020-01-29
Answer
You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2020-01-29
Question
Is a blocking peptide available for product anti-CCR3 antibody (A01748-1)?
Verified Customer
Verified customer
Asked: 2019-07-18
Answer
We do provide the blocking peptide for product anti-CCR3 antibody (A01748-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-07-18
Question
We bought anti-CCR3 antibody for Flow Cytometry on monocyte a few months ago. I am using rat, and We intend to use the antibody for IHC next. My question regards examining monocyte as well as blood in our next experiment. Could give a recommendation on which antibody would work the best for IHC?
Verified Customer
Verified customer
Asked: 2019-07-02
Answer
I have checked the website and datasheets of our anti-CCR3 antibody and it seems that A01748-1 has been validated on rat in both Flow Cytometry and IHC. Thus A01748-1 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2019-07-02
Question
We have seen staining in rat synovium. Are there any suggestions? Is anti-CCR3 antibody supposed to stain synovium positively?
Verified Customer
Verified customer
Asked: 2019-06-27
Answer
Based on literature synovium does express CCR3. Based on Uniprot.org, CCR3 is expressed in blood, monocyte, synovium, among other tissues. Regarding which tissues have CCR3 expression, here are a few articles citing expression in various tissues:
Blood, Pubmed ID: 15489334
Monocyte, Pubmed ID: 7622448
Synovium, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2019-06-27
Question
I was wanting to use your anti-CCR3 antibody for IHC for rat monocyte on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat monocyte identification?
Verified Customer
Verified customer
Asked: 2019-05-20
Answer
As indicated on the product datasheet, A01748-1 anti-CCR3 antibody has been tested for Flow Cytometry, IHC, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat monocyte in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-05-20
Question
My question regarding product A01748-1, anti-CCR3 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
K. Li
Verified customer
Asked: 2019-04-05
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01748-1 anti-CCR3 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-04-05
Question
Please see the WB image, lot number and protocol we used for monocyte using anti-CCR3 antibody A01748-1. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-01-17
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-01-17
Question
My question regards to test anti-CCR3 antibody A01748-1 on rat monocyte for research purposes, then I may be interested in using anti-CCR3 antibody A01748-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2018-10-03
Answer
The products we sell, including anti-CCR3 antibody A01748-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-10-03
Question
Is this A01748-1 anti-CCR3 antibody reactive to the isotypes of CCR3?
Verified Customer
Verified customer
Asked: 2017-09-08
Answer
The immunogen of A01748-1 anti-CCR3 antibody is A synthetic peptide corresponding to a sequence of human CCR3 (MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMA). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2017-09-08
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for monocyte using anti-CCR3 antibody A01748-1. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2017-06-14
Answer
Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2017-06-14
Question
We are currently using anti-CCR3 antibody A01748-1 for rat tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on feline tissues as well?
N. Thomas
Verified customer
Asked: 2017-01-30
Answer
The anti-CCR3 antibody (A01748-1) has not been validated for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2017-01-30
Question
Do you have a BSA free version of anti-CCR3 antibody A01748-1 available?
P. Wu
Verified customer
Asked: 2015-10-01
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-CCR3 antibody A01748-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2015-10-01
Question
Will A01748-1 anti-CCR3 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
L. Wu
Verified customer
Asked: 2013-01-22
Answer
You can see on the product datasheet, A01748-1 anti-CCR3 antibody as been validated on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2013-01-22
