Product Info Summary
SKU: | PB9708 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-GRK5 Antibody Picoband™
SKU/Catalog Number
PB9708
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-GRK5 Antibody Picoband™ catalog # PB9708. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-GRK5 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9708)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human GRK5, different from the related mouse and rat sequences by three amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9708 is reactive to GRK5 in Human, Mouse, Rat
Applications
PB9708 is guaranteed for IHC, WB Boster Guarantee
Observed Molecular Weight
68 kDa
Calculated molecular weight
67787 MW
Background of GRK5
G protein-coupled receptor kinase 5 is an enzyme that in humans is encoded by the GRK5 gene. It is mapped to 10q26.11. This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs).
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Validation Images & Assay Conditions
![pb9708 grk5 primary antibodies wb testing 1 pb9708 grk5 primary antibodies wb testing 1](https://www.bosterbio.com/media/catalog/product/p/b/pb9708-grk5-primary-antibodies-wb-testing-1.jpg)
Click image to see more details
Figure 1. Western blot analysis of GRK5 using anti-GRK5 antibody (PB9708).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human HepG2 whole cell lysates,
Lane 2: human Hela whole cell lysates,
Lane 3: human A549 whole cell lysates,
Lane 4: rat heart tissue lysates,
Lane 5: mouse heart tissue lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-GRK5 antigen affinity purified polyclonal antibody (Catalog # PB9708) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for GRK5 at approximately 68 kDa. The expected band size for GRK5 is at 68 kDa.
![pb9708 2 IHC anti grk5 picoband antibody pb9708 2 IHC anti grk5 picoband antibody](https://www.bosterbio.com/media/catalog/product/antibody/pb9708-2-IHC-anti-grk5-picoband-antibody.jpg)
Click image to see more details
Figure 2. IHC analysis of GRK5 using anti-GRK5 antibody (PB9708).
GRK5 was detected in a paraffin-embedded section of rat cardiac muscle tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-GRK5 Antibody (PB9708) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
![pb9708 3 IHC anti grk5 picoband antibody pb9708 3 IHC anti grk5 picoband antibody](https://www.bosterbio.com/media/catalog/product/antibody/pb9708-3-IHC-anti-grk5-picoband-antibody.jpg)
Click image to see more details
Figure 3. IHC analysis of GRK5 using anti-GRK5 antibody (PB9708).
GRK5 was detected in a paraffin-embedded section of mouse lung tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-GRK5 Antibody (PB9708) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
![pb9708 4 IHC anti grk5 picoband antibody pb9708 4 IHC anti grk5 picoband antibody](https://www.bosterbio.com/media/catalog/product/antibody/pb9708-4-IHC-anti-grk5-picoband-antibody.jpg)
Click image to see more details
Figure 4. IHC analysis of GRK5 using anti-GRK5 antibody (PB9708).
GRK5 was detected in a paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-GRK5 Antibody (PB9708) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For GRK5 (Source: Uniprot.org, NCBI)
Gene Name
GRK5
Full Name
G protein-coupled receptor kinase 5
Weight
67787 MW
Superfamily
protein kinase superfamily
Alternative Names
EC 2.7.11; EC 2.7.11.16; FLJ39780; G protein-coupled receptor kinase 5; G protein-coupled receptor kinase GRK5; GPRK5; GPRK5FP2025; GRK5 GRK5 FP2025, GPRK5 G protein-coupled receptor kinase 5 G protein-coupled receptor kinase 5|g protein-coupled receptor kinase GRK5
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on GRK5, check out the GRK5 Infographic
![GRK5 infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for GRK5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-GRK5 Antibody Picoband™ (PB9708)
Hello CJ!
No publications found for PB9708
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-GRK5 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
1 Reviews For Anti-GRK5 Antibody Picoband™
0
Anti GRK5 (PB 9708) is useful, good.--Yongzhen Guo, EMERGENCY MEDICINE, THOMAS JEFFERSON UNIVERSITY, RESEARCH ASSISTANT
Excellent
![](/media/images/testimonials/gapdh.jpg)
Source: Biocompare.com
Applications | Western Blot |
---|---|
Sample | Rat endothelial cells |
Detection | Kodak Image Station 4000R Pro;Thermo Scientific West Femto Maximum Sensitivity Substrate(#34096) |
"After using this antibody for western blot to analyze rat endothelial cells' protein, I found PB9708 Anti-GRK5 antibody worked very well. The blot of 68 Kda can be seen, however, we can see another 3 blots at least. In a word, Anti GRK5 (PB 9708) is useful and good. The blot of 68 Kda can be detected."
Yongzhen Guo
Verified customer
Submitted 2016-08-24
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-GRK5 Antibody Picoband™
Question
Is there a BSA free version of anti-GRK5 antibody PB9708 available?
Verified Customer
Verified customer
Asked: 2020-04-22
Answer
Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-GRK5 antibody PB9708 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-04-22
Question
Is this PB9708 anti-GRK5 antibody reactive to the isotypes of GRK5?
Verified Customer
Verified customer
Asked: 2019-11-21
Answer
The immunogen of PB9708 anti-GRK5 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human GRK5 (393-429aa KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK), different from the related mouse and rat sequences by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-11-21
Question
My question regarding product PB9708, anti-GRK5 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-10-23
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9708 anti-GRK5 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-10-23
Question
Will anti-GRK5 antibody PB9708 work for WB with right lung?
Verified Customer
Verified customer
Asked: 2019-09-16
Answer
According to the expression profile of right lung, GRK5 is highly expressed in right lung. So, it is likely that anti-GRK5 antibody PB9708 will work for WB with right lung.
Boster Scientific Support
Answered: 2019-09-16
Question
I have attached the WB image, lot number and protocol we used for right lung using anti-GRK5 antibody PB9708. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-09-11
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-09-11
Question
I see that the anti-GRK5 antibody PB9708 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2018-06-29
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2018-06-29
Question
We are currently using anti-GRK5 antibody PB9708 for mouse tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on primate tissues as well?
Verified Customer
Verified customer
Asked: 2017-07-07
Answer
The anti-GRK5 antibody (PB9708) has not been validated for cross reactivity specifically with primate tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2017-07-07