Anti-GRK5 Antibody Picoband™

GRK5 antibody

Boster Bio Anti-GRK5 Antibody Picoband™ catalog # PB9708. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. Independently reviewed in 1 review(s).

Product Info Summary

SKU: PB9708
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-GRK5 Antibody Picoband™

View all GRK5 Antibodies

SKU/Catalog Number

PB9708

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-GRK5 Antibody Picoband™ catalog # PB9708. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-GRK5 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9708)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human GRK5, different from the related mouse and rat sequences by three amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9708 is reactive to GRK5 in Human, Mouse, Rat

Applications

PB9708 is guaranteed for IHC, WB Boster Guarantee

Observed Molecular Weight

68 kDa

Calculated molecular weight

67787 MW

Background of GRK5

G protein-coupled receptor kinase 5 is an enzyme that in humans is encoded by the GRK5 gene. It is mapped to 10q26.11. This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs).

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat

Validation Images & Assay Conditions

Gene/Protein Information For GRK5 (Source: Uniprot.org, NCBI)

Gene Name

GRK5

Full Name

G protein-coupled receptor kinase 5

Weight

67787 MW

Superfamily

protein kinase superfamily

Alternative Names

EC 2.7.11; EC 2.7.11.16; FLJ39780; G protein-coupled receptor kinase 5; G protein-coupled receptor kinase GRK5; GPRK5; GPRK5FP2025; GRK5 GRK5 FP2025, GPRK5 G protein-coupled receptor kinase 5 G protein-coupled receptor kinase 5|g protein-coupled receptor kinase GRK5

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on GRK5, check out the GRK5 Infographic

GRK5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GRK5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB9708

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-GRK5 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

1 Reviews For Anti-GRK5 Antibody Picoband™

0

Anti GRK5 (PB 9708) is useful, good.--Yongzhen Guo, EMERGENCY MEDICINE, THOMAS JEFFERSON UNIVERSITY, RESEARCH ASSISTANT

Excellent

Source: Biocompare.com

Applications Western Blot
Sample Rat endothelial cells
Detection Kodak Image Station 4000R Pro;Thermo Scientific West Femto Maximum Sensitivity Substrate(#34096)

"After using this antibody for western blot to analyze rat endothelial cells' protein, I found PB9708 Anti-GRK5 antibody worked very well. The blot of 68 Kda can be seen, however, we can see another 3 blots at least. In a word, Anti GRK5 (PB 9708) is useful and good. The blot of 68 Kda can be detected."

Verified customer

Submitted

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-GRK5 Antibody Picoband™

Question

Is there a BSA free version of anti-GRK5 antibody PB9708 available?

Verified Customer

Verified customer

Asked: 2020-04-22

Answer

Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-GRK5 antibody PB9708 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-04-22

Question

Is this PB9708 anti-GRK5 antibody reactive to the isotypes of GRK5?

Verified Customer

Verified customer

Asked: 2019-11-21

Answer

The immunogen of PB9708 anti-GRK5 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human GRK5 (393-429aa KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK), different from the related mouse and rat sequences by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-11-21

Question

My question regarding product PB9708, anti-GRK5 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-10-23

Answer

It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9708 anti-GRK5 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-10-23

Question

Will anti-GRK5 antibody PB9708 work for WB with right lung?

Verified Customer

Verified customer

Asked: 2019-09-16

Answer

According to the expression profile of right lung, GRK5 is highly expressed in right lung. So, it is likely that anti-GRK5 antibody PB9708 will work for WB with right lung.

Boster Scientific Support

Answered: 2019-09-16

Question

I have attached the WB image, lot number and protocol we used for right lung using anti-GRK5 antibody PB9708. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-09-11

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-09-11

Question

I see that the anti-GRK5 antibody PB9708 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2018-06-29

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2018-06-29

Question

We are currently using anti-GRK5 antibody PB9708 for mouse tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on primate tissues as well?

Verified Customer

Verified customer

Asked: 2017-07-07

Answer

The anti-GRK5 antibody (PB9708) has not been validated for cross reactivity specifically with primate tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2017-07-07

Order DetailsPrice
PB9708

100μg

$370
PB9708-10ug

10μg sample (liquid)

$99
PB9708-Biotin

100 μg Biotin conjugated

$570
PB9708-Cy3

100 μg Cy3 conjugated

$570
PB9708-Dylight488

100 μg Dylight488 conjugated

$570
PB9708-Dylight550

100 μg Dylight550 conjugated

$570
PB9708-Dylight594

100 μg Dylight594 conjugated

$570
PB9708-FITC

100 μg FITC conjugated

$570
PB9708-HRP

100 μg HRP conjugated

$570
PB9708-APC

100 μg APC conjugated

$670
PB9708-PE

100 μg PE conjugated

$670
PB9708-iFluor647

100 μg iFluor647 conjugated

$670
PB9708-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9708
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.