Anti-ACCN1/ASIC2 Antibody Picoband®

ACCN1 antibody

Boster Bio Anti-ACCN1/ASIC2 Antibody Picoband® catalog # PB10046. Tested in WB applications. This antibody reacts with Human, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: PB10046
Size: 100 μg/vial
Reactive Species: Human, Rat
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-ACCN1/ASIC2 Antibody Picoband®

View all ACCN1 Antibodies

SKU/Catalog Number

PB10046
PB1077 is an alternative SKU for this antibody, used in previous lots.

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-ACCN1/ASIC2 Antibody Picoband® catalog # PB10046. Tested in WB applications. This antibody reacts with Human, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-ACCN1/ASIC2 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10046)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human ACCN1, different from the related mouse and rat sequences by one amino acid.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB10046 is reactive to ASIC2 in Human, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

65 kDa

Calculated molecular weight

57709 MW

Background of ACCN1

Amiloride-sensitive cation channel 1, neuronal, also known as ASIC2, is a protein that in humans is encoded by the ACCN1 gene. This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene may play a role in neurotransmission. In addition, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 3 has been observed to co-assemble into proton-gated channels sensitive to gadolinium. Alternative splicing has been observed at this locus and two variants, encoding distinct isoforms, have been identified.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB10046 is guaranteed for WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Rat

Positive Control

WB: rat testis tissue, MCF-7 whole cell

Validation Images & Assay Conditions

Gene/Protein Information For ASIC2 (Source: Uniprot.org, NCBI)

Gene Name

ASIC2

Full Name

Acid-sensing ion channel 2

Weight

57709 MW

Superfamily

amiloride-sensitive sodium channel (TC 1.A.6) family

Alternative Names

Acid-sensing ion channel 2;ASIC2;Amiloride-sensitive brain sodium channel;Amiloride-sensitive cation channel 1, neuronal;Amiloride-sensitive cation channel neuronal 1;Brain sodium channel 1;BNC1;BNaC1;Mammalian degenerin homolog;ASIC2;ACCN, ACCN1, BNAC1, MDEG; ASIC2 ACCN, ACCN1a, BNC1, BNaC1, MDEG, hBNaC1, ASIC2 acid sensing ion channel subunit 2 acid-sensing ion channel 2|acid sensing (proton gated) ion channel 2|amiloride-sensitive cation channel 1, neuronal|brain sodium channel 1|mammalian degenerin homolog|neuronal amiloride-sensitive cation channel 1

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on ASIC2, check out the ASIC2 Infographic

ASIC2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ASIC2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB10046

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-ACCN1/ASIC2 Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-ACCN1/ASIC2 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-ACCN1/ASIC2 Antibody Picoband®

Question

Will PB10046 anti-ACCN1/ASIC2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

N. Jha

Verified customer

Asked: 2019-10-18

Answer

It shows on the product datasheet, PB10046 anti-ACCN1/ASIC2 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-10-18

Question

Is this PB10046 anti-ACCN1/ASIC2 antibody reactive to the isotypes of ASIC2?

Verified Customer

Verified customer

Asked: 2019-01-02

Answer

The immunogen of PB10046 anti-ACCN1/ASIC2 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human ACCN1 (112-147aa ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK), different from the related mouse and rat sequences by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-01-02

Question

Would anti-ACCN1/ASIC2 antibody PB10046 work on monkey WB with brain?

P. Baker

Verified customer

Asked: 2018-01-26

Answer

Our lab technicians have not tested anti-ACCN1/ASIC2 antibody PB10046 on monkey. You can run a BLAST between monkey and the immunogen sequence of anti-ACCN1/ASIC2 antibody PB10046 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated monkey samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in monkey brain in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-01-26

Question

Is a blocking peptide available for product anti-ACCN1/ASIC2 antibody (PB10046)?

Verified Customer

Verified customer

Asked: 2017-07-27

Answer

We do provide the blocking peptide for product anti-ACCN1/ASIC2 antibody (PB10046). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2017-07-27

Question

We are currently using anti-ACCN1/ASIC2 antibody PB10046 for rat tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, rat. Is it possible that the antibody can work on feline tissues as well?

Verified Customer

Verified customer

Asked: 2017-05-12

Answer

The anti-ACCN1/ASIC2 antibody (PB10046) has not been validated for cross reactivity specifically with feline tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2017-05-12

Question

I was wanting to use your anti-ACCN1/ASIC2 antibody for WB for human frontal cortex on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human frontal cortex identification?

A. Patel

Verified customer

Asked: 2016-08-01

Answer

As indicated on the product datasheet, PB10046 anti-ACCN1/ASIC2 antibody has been tested for WB on human, rat tissues. We have an innovator award program that if you test this antibody and show it works in human frontal cortex in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2016-08-01

Question

Can you help my question with product PB10046, anti-ACCN1/ASIC2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

K. Krishna

Verified customer

Asked: 2014-06-06

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB10046 anti-ACCN1/ASIC2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2014-06-06

Order DetailsPrice
PB10046

100μg

$370
PB10046-10ug

10μg sample (liquid)

$99
PB10046-Biotin

100 μg Biotin conjugated

$570
PB10046-Cy3

100 μg Cy3 conjugated

$570
PB10046-Dylight488

100 μg Dylight488 conjugated

$570
PB10046-Dylight550

100 μg Dylight550 conjugated

$570
PB10046-Dylight594

100 μg Dylight594 conjugated

$570
PB10046-FITC

100 μg FITC conjugated

$570
PB10046-HRP

100 μg HRP conjugated

$570
PB10046-APC

100 μg APC conjugated

$670
PB10046-PE

100 μg PE conjugated

$670
PB10046-iFluor647

100 μg iFluor647 conjugated

$670
PB10046-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB10046
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.