Anti-SRI Antibody Picoband®

SR1 antibody

Boster Bio Anti-SRI Antibody Picoband® catalog # A00222. Tested in Flow Cytometry, IF, IHC, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: A00222
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC, IHC-F, ICC, WB

Customers Who Bought This Also Bought

Product Name

Anti-SRI Antibody Picoband®

View all SR1 Antibodies

SKU/Catalog Number

A00222

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-SRI Antibody Picoband® catalog # A00222. Tested in Flow Cytometry, IF, IHC, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SRI Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00222)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human SRI, which shares 93.3% amino acid (aa) sequence identity with both mouse and rat SRI.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00222 is reactive to SRI in Human, Mouse, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

22 kDa

Calculated molecular weight

21.676kDa

Background of SR1

Sorcin is a protein that in humans is encoded by the SRI gene. It is mapped to 7q21.1. This gene encodes a calcium-binding protein with multiple E-F hand domains that relocates from the cytoplasm to the sarcoplasmic reticulum in response to elevated calcium levels. In addition to regulating intracellular calcium homeostasis it also modulates excitation-contraction coupling in the heart. Alternative splicing results in multiple transcript variants encoding distinct proteins. Multiple pseudogenes exist for this gene. 

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A00222 is guaranteed for Flow Cytometry, IF, IHC, IHC-F, ICC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunohistochemistry (Frozen Section), 0.5-1μg/ml
Immunocytochemistry/Immunofluorescence, 2μg/ml
Flow Cytometry (Fixed), 1-3μg/1x106 cells

Positive Control

WB: human placenta tissue, human U20S whole cell, human A431 whole cell, human PC-3 whole cell, human HL-60 whole cell, human K562 whole cell, human Caco-2 whole cell, rat lung tissue, mouse lung tissue
IHC: human intestinal cancer tissue, human lung cancer tissue, human mammary cancer tissue
ICC/IF: U20S cell
FCM: SiHa cell, U20S cell

Validation Images & Assay Conditions

Gene/Protein Information For SRI (Source: Uniprot.org, NCBI)

Gene Name

SRI

Full Name

Sorcin

Weight

21.676kDa

Alternative Names

Sorcin; 22 kDa protein; CP-22; CP22; V19; SRI SRI CP-22, CP22, SCN, V19 sorcin sorcin|22 kDa protein|H_RG167B05.1|calcium binding protein amplified in mutlidrug-resistant cells

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on SRI, check out the SRI Infographic

SRI infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SRI: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A00222

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-SRI Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-SRI Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-SRI Antibody Picoband®

Question

Is a blocking peptide available for product anti-SRI antibody (A00222)?

Verified Customer

Verified customer

Asked: 2019-11-28

Answer

We do provide the blocking peptide for product anti-SRI antibody (A00222). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-11-28

Question

I see that the anti-SRI antibody A00222 works with IHC-P, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-08-23

Answer

You can find protocols for IHC-P on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-08-23

Question

Please see the WB image, lot number and protocol we used for brain using anti-SRI antibody A00222. Please let me know if you require anything else.

C. Banerjee

Verified customer

Asked: 2019-04-15

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-04-15

Question

Is this A00222 anti-SRI antibody reactive to the isotypes of SRI?

S. Li

Verified customer

Asked: 2016-06-06

Answer

The immunogen of A00222 anti-SRI antibody is A synthetic peptide corresponding to a sequence of human SRI (TVDPQELQKALTTMGFRLSPQAVNSIAKRY). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2016-06-06

Order DetailsPrice
A00222

100μg

$370
A00222-10ug

10μg sample (liquid)

$99
A00222-Biotin

100 μg Biotin conjugated

$570
A00222-Cy3

100 μg Cy3 conjugated

$570
A00222-Dylight488

100 μg Dylight488 conjugated

$570
A00222-Dylight550

100 μg Dylight550 conjugated

$570
A00222-Dylight594

100 μg Dylight594 conjugated

$570
A00222-FITC

100 μg FITC conjugated

$570
A00222-HRP

100 μg HRP conjugated

$570
A00222-APC

100 μg APC conjugated

$670
A00222-PE

100 μg PE conjugated

$670
A00222-iFluor647

100 μg iFluor647 conjugated

$670
A00222-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A00222
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.