Product Info Summary
SKU: | A00222 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IF, IHC, IHC-F, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-SRI Antibody Picoband®
SKU/Catalog Number
A00222
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-SRI Antibody Picoband® catalog # A00222. Tested in Flow Cytometry, IF, IHC, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-SRI Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00222)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human SRI, which shares 93.3% amino acid (aa) sequence identity with both mouse and rat SRI.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00222 is reactive to SRI in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
22 kDa
Calculated molecular weight
21.676kDa
Background of SR1
Sorcin is a protein that in humans is encoded by the SRI gene. It is mapped to 7q21.1. This gene encodes a calcium-binding protein with multiple E-F hand domains that relocates from the cytoplasm to the sarcoplasmic reticulum in response to elevated calcium levels. In addition to regulating intracellular calcium homeostasis it also modulates excitation-contraction coupling in the heart. Alternative splicing results in multiple transcript variants encoding distinct proteins. Multiple pseudogenes exist for this gene.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00222 is guaranteed for Flow Cytometry, IF, IHC, IHC-F, ICC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunohistochemistry (Frozen Section), 0.5-1μg/ml
Immunocytochemistry/Immunofluorescence, 2μg/ml
Flow Cytometry (Fixed), 1-3μg/1x106 cells
Positive Control
WB: human placenta tissue, human U20S whole cell, human A431 whole cell, human PC-3 whole cell, human HL-60 whole cell, human K562 whole cell, human Caco-2 whole cell, rat lung tissue, mouse lung tissue
IHC: human intestinal cancer tissue, human lung cancer tissue, human mammary cancer tissue
ICC/IF: U20S cell
FCM: SiHa cell, U20S cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of SR1 using anti-SR1 antibody (A00222).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human placenta tissue lysate,
Lane 2: human U20S whole cell lysate,
Lane 3: human A431 whole cell lysate,
Lane 4: human PC-3 whole cell lysate,
Lane 5: human HL-60 whole cell lysate,
Lane 6: human K562 whole cell lysate,
Lane 7: human Caco-2 whole cell lysate,
Lane 8: rat lung tissue lysate,
Lane 9: mouse lung tissue lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SR1 antigen affinity purified polyclonal antibody (Catalog # A00222) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for SR1 at approximately 22KD. The expected band size for SR1 is at 22KD.
Click image to see more details
Figure 2. IHC analysis of SRI using anti-SRI antibody (A00222).
SRI was detected in paraffin-embedded section of human intestinal cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-SRI Antibody (A00222) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of SRI using anti-SRI antibody (A00222).
SRI was detected in paraffin-embedded section of human lung cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-SRI Antibody (A00222) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of SRI using anti-SRI antibody (A00222).
SRI was detected in paraffin-embedded section of human mammary cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-SRI Antibody (A00222) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 5. IF analysis of SRI using anti-SRI antibody (A00222)
SRI was detected in immunocytochemical section of U20S cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL rabbit anti-SRI Antibody (A00222) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 6. Flow Cytometry analysis of SiHa cells using anti-SRI antibody (A00222).
Overlay histogram showing SiHa cells stained with A00222 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-SRI Antibody (A00222,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Click image to see more details
Figure 7. Flow Cytometry analysis of U20S cells using anti-SRI antibody (A00222).
Overlay histogram showing U20S cells stained with A00222 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-SRI Antibody (A00222,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Protein Target Info & Infographic
Gene/Protein Information For SRI (Source: Uniprot.org, NCBI)
Gene Name
SRI
Full Name
Sorcin
Weight
21.676kDa
Alternative Names
Sorcin; 22 kDa protein; CP-22; CP22; V19; SRI SRI CP-22, CP22, SCN, V19 sorcin sorcin|22 kDa protein|H_RG167B05.1|calcium binding protein amplified in mutlidrug-resistant cells
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on SRI, check out the SRI Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for SRI: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-SRI Antibody Picoband® (A00222)
Hello CJ!
No publications found for A00222
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-SRI Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-SRI Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
4 Customer Q&As for Anti-SRI Antibody Picoband®
Question
Is a blocking peptide available for product anti-SRI antibody (A00222)?
Verified Customer
Verified customer
Asked: 2019-11-28
Answer
We do provide the blocking peptide for product anti-SRI antibody (A00222). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-11-28
Question
I see that the anti-SRI antibody A00222 works with IHC-P, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-08-23
Answer
You can find protocols for IHC-P on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-08-23
Question
Please see the WB image, lot number and protocol we used for brain using anti-SRI antibody A00222. Please let me know if you require anything else.
C. Banerjee
Verified customer
Asked: 2019-04-15
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-04-15
Question
Is this A00222 anti-SRI antibody reactive to the isotypes of SRI?
S. Li
Verified customer
Asked: 2016-06-06
Answer
The immunogen of A00222 anti-SRI antibody is A synthetic peptide corresponding to a sequence of human SRI (TVDPQELQKALTTMGFRLSPQAVNSIAKRY). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2016-06-06