Click image to see more details
Product Info Summary
| SKU: | PB9995 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Rat |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Cdk6 Antibody Picoband®
SKU/Catalog Number
PB9995
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Cdk6 Antibody Picoband® catalog # PB9995. Tested in IHC, WB applications. This antibody reacts with Human, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Cdk6 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9995)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Cdk6, identical to the related mouse sequence.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9995 is reactive to CDK6 in Human, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
39 kDa
Calculated molecular weight
36938 MW
Background of CDK6
Cell division protein kinase 6, also called Plstire, is an enzyme that in humans is encoded by the CDK6 gene. The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. Radiation hybrid analysis and inclusion within a mapped clone place the CDK6 gene at 7q21. Serine/threonine-protein kinase involved in the control of the cell cycle and differentiation and promotes G1/S transition. This gene also involved in initiation and maintenance of cell cycle exit during cell differentiation. It prevents cell proliferation and regulates negatively cell differentiation, but is required for the proliferation of specific cell types. In addition, CDK6 plays a role in promoting the proliferation of beta-cells in pancreatic islets of Langerhans.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9995 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Positive Control
IHC: human intestinal cancer tissue, human mammary cancer tissue, human tonsil tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. IHC analysis of Cdk6 using anti-Cdk6 antibody (PB9995).
Cdk6 was detected in paraffin-embedded section of human intestinal cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Cdk6 Antibody (PB9995) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 2. IHC analysis of Cdk6 using anti-Cdk6 antibody (PB9995).
Cdk6 was detected in paraffin-embedded section of human mammary cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Cdk6 Antibody (PB9995) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of Cdk6 using anti-Cdk6 antibody (PB9995).
Cdk6 was detected in paraffin-embedded section of human tonsil tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Cdk6 Antibody (PB9995) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For CDK6 (Source: Uniprot.org, NCBI)
Gene Name
CDK6
Full Name
Cyclin-dependent kinase 6
Weight
36938 MW
Superfamily
protein kinase superfamily
Alternative Names
Cyclin-dependent kinase 6;2.7.11.22;Cell division protein kinase 6;Serine/threonine-protein kinase PLSTIRE;CDK6;CDKN6; CDK6 MCPH12, PLSTIRE cyclin dependent kinase 6 cyclin-dependent kinase 6|cell division protein kinase 6|serine/threonine-protein kinase PLSTIRE
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on CDK6, check out the CDK6 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CDK6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Cdk6 Antibody Picoband® (PB9995)
Hello CJ!
PB9995 has been cited in 4 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Sun D,Zhao T,Long K,Wu M,Zhang Z.Triclosan down-regulates fatty acid synthase through microRNAs in HepG2 cells.Eur J Pharmacol .2021 Jun 15:174261.doi:10.1016/j.ejphar.2021.174261.Epub ahead of print.PMID:34144025.
Species: Human
PB9995 usage in article: APP:WB, SAMPLE:HEPG2 CELL, DILUTION:1:400
Long noncoding RNA NEAT1 promotes laryngeal squamous cell cancer through regulating miR-107/CDK6 pathway
Li P, Chen H, Chen S, Mo X, Li T, Xiao B, Yu R, Guo J. Br J Cancer. 2017 Feb 28;116(5):626-633. doi: 10.1038/bjc.2016.451. Epub 2017 Jan 12 Circular RNA 0000096 affects cell growth and migration in gastric cancer
Zhou R, Lu Z, Liu K, Guo J, Liu J, Zhou Y, Yang J, Mi M, Xu H. Curr Cancer Drug Targets. 2015;14(9):860-71. Platycodin D Induces Tumor Growth Arrest By Activating Foxo3A Expression In Prostate Cancer In Vitro And In Vivo.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Cdk6 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Cdk6 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-Cdk6 Antibody Picoband®
Question
I see that the anti-Cdk6 antibody PB9995 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2020-04-02
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2020-04-02
Question
We have been able to see staining in rat leukemic t-cell. Are there any suggestions? Is anti-Cdk6 antibody supposed to stain leukemic t-cell positively?
Verified Customer
Verified customer
Asked: 2020-02-24
Answer
From what I have seen in literature leukemic t-cell does express CDK6. From what I have seen in Uniprot.org, CDK6 is expressed in adrenal tissue, tongue, brain, leukemic t-cell, among other tissues. Regarding which tissues have CDK6 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 15489334
Leukemic T-cell, Pubmed ID: 19690332
Tongue, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2020-02-24
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for leukemic t-cell using anti-Cdk6 antibody PB9995. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-12-06
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-12-06
Question
We are currently using anti-Cdk6 antibody PB9995 for human tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, rat. Is it likely that the antibody can work on goat tissues as well?
Verified Customer
Verified customer
Asked: 2019-07-19
Answer
The anti-Cdk6 antibody (PB9995) has not been validated for cross reactivity specifically with goat tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-07-19
Question
Is this PB9995 anti-Cdk6 antibody reactive to the isotypes of CDK6?
N. Wu
Verified customer
Asked: 2019-07-17
Answer
The immunogen of PB9995 anti-Cdk6 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Cdk6 (119-150aa TETIKDMMFQLLRGLDFLHSHRVVHRDLKPQN), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-07-17
Question
My colleagues were content with the WB result of your anti-Cdk6 antibody. However we have seen positive staining in tongue cytoplasm. nucleus. cell projection using this antibody. Is that expected? Could you tell me where is CDK6 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-07-11
Answer
From what I have seen in literature, tongue does express CDK6. Generally CDK6 expresses in cytoplasm. nucleus. cell projection, ruffle. Regarding which tissues have CDK6 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 15489334
Leukemic T-cell, Pubmed ID: 19690332
Tongue, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2019-07-11
Question
Would PB9995 anti-Cdk6 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
R. Miller
Verified customer
Asked: 2019-07-09
Answer
You can see on the product datasheet, PB9995 anti-Cdk6 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-07-09
Question
I was wanting to use your anti-Cdk6 antibody for WB for rat leukemic t-cell on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat leukemic t-cell identification?
S. Carter
Verified customer
Asked: 2019-04-18
Answer
As indicated on the product datasheet, PB9995 anti-Cdk6 antibody has been tested for IHC, WB on human, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat leukemic t-cell in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-04-18
Question
I have a question about product PB9995, anti-Cdk6 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
M. Jones
Verified customer
Asked: 2018-10-24
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9995 anti-Cdk6 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2018-10-24
Question
Please see the WB image, lot number and protocol we used for leukemic t-cell using anti-Cdk6 antibody PB9995. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2018-09-11
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-09-11
Question
you antibody to test anti-Cdk6 antibody PB9995 on rat leukemic t-cell for research purposes, then I may be interested in using anti-Cdk6 antibody PB9995 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2018-03-20
Answer
The products we sell, including anti-Cdk6 antibody PB9995, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-03-20
Question
We bought anti-Cdk6 antibody for IHC on leukemic t-cell in a previous experiment. I am using human, and I plan to use the antibody for WB next. Our lab want to know about examining leukemic t-cell as well as brain in our next experiment. Do you have any suggestion on which antibody would work the best for WB?
Verified Customer
Verified customer
Asked: 2018-03-12
Answer
I looked at the website and datasheets of our anti-Cdk6 antibody and I see that PB9995 has been validated on human in both IHC and WB. Thus PB9995 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2018-03-12
Question
Is a blocking peptide available for product anti-Cdk6 antibody (PB9995)?
E. Bhatt
Verified customer
Asked: 2018-01-17
Answer
We do provide the blocking peptide for product anti-Cdk6 antibody (PB9995). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2018-01-17
Question
Would anti-Cdk6 antibody PB9995 work for WB with leukemic t-cell?
Verified Customer
Verified customer
Asked: 2018-01-17
Answer
According to the expression profile of leukemic t-cell, CDK6 is highly expressed in leukemic t-cell. So, it is likely that anti-Cdk6 antibody PB9995 will work for WB with leukemic t-cell.
Boster Scientific Support
Answered: 2018-01-17
Question
Do you have a BSA free version of anti-Cdk6 antibody PB9995 available?
Verified Customer
Verified customer
Asked: 2017-06-13
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Cdk6 antibody PB9995 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2017-06-13
