CDK6 (NM_001145306) Human Recombinant Protein

CDK6 protein,

Purified recombinant protein of Homo sapiens cyclin-dependent kinase 6 (CDK6)

Product Info Summary

SKU: PROTQ00534
Size: 20 µg
Source: HEK293T

Product Name

CDK6 (NM_001145306) Human Recombinant Protein

View all CDK6 recombinant proteins

SKU/Catalog Number

PROTQ00534

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens cyclin-dependent kinase 6 (CDK6)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CDK6 (NM_001145306) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ00534)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

36.8 kDa

Amino Acid Sequence

MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA

Validation Images & Assay Conditions

Gene/Protein Information For CDK6 (Source: Uniprot.org, NCBI)

Gene Name

CDK6

Full Name

Cyclin-dependent kinase 6

Weight

36.8 kDa

Superfamily

protein kinase superfamily

Alternative Names

Cell division protein kinase 6; cyclin-dependent kinase 6; EC 2.7.11; EC 2.7.11.22; PLSTIREMGC59692; Serine/threonine-protein kinase PLSTIRE CDK6 MCPH12, PLSTIRE cyclin dependent kinase 6 cyclin-dependent kinase 6|cell division protein kinase 6|serine/threonine-protein kinase PLSTIRE

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CDK6, check out the CDK6 Infographic

CDK6 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CDK6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ00534

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CDK6 (NM_001145306) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CDK6 (NM_001145306) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CDK6 (NM_001145306) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ00534
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.